PaperBLAST – Find papers about a protein or its homologs

 

Align XP_006502103.1 to PF05527 (DUF758)

XP_006502103.1 has 184 amino acids

Query:       DUF758  [M=181]
Accession:   PF05527.11
Description: Domain of unknown function (DUF758)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    4.7e-77  244.2   0.0    5.3e-77  244.1   0.0    1.0  1  XP_006502103.1  


Domain annotation for each sequence (and alignments):
>> XP_006502103.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  244.1   0.0   5.3e-77   5.3e-77       1     181 []       4     182 ..       4     182 .. 0.99

  Alignments for each domain:
  == domain 1  score: 244.1 bits;  conditional E-value: 5.3e-77
          DUF758   1 FsskdlalraqKkllgkmasksvaklfiddtsselldelykllkeytgnkkeaekvvKniiKvvvKvgvllrnkqlsaeelallekfrkklrtla 95 
                     Fssk+lal+a+Kkll+kma++sva+lfid+tsse+ldely+++keyt+++ +a++v+K++iKv+vKv+vl+r++++ + elal+++fr+klr+ a
  XP_006502103.1   4 FSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPKAQRVIKDLIKVAVKVAVLHRSGCFGPGELALATRFRQKLRQGA 98 
                     99********************************************************************************************* PP

          DUF758  96 mtlisfyevdftfdkavLadlLkecrellkqlverhLtdkslgridhvfdflsdpefldalfspdseyrellkkivddLnklldeg 181
                     mt++sf evdftf++avLa lL ecr++l++lve+hLt+ks++ri+hvfd++sdp++l+al+ pd  + ++l+ki+d+L+klldeg
  XP_006502103.1  99 MTALSFGEVDFTFEAAVLAGLLVECRDILLELVEHHLTPKSHDRIRHVFDHYSDPDLLAALYGPD--FTQHLGKICDGLRKLLDEG 182
                     **************************************************************666..*****************97 PP



Or compare XP_006502103.1 to CDD or PaperBLAST