PaperBLAST – Find papers about a protein or its homologs

 

Align XP_013852617.1 to PF05527 (DUF758)

XP_013852617.1 has 199 amino acids

Query:       DUF758  [M=181]
Accession:   PF05527.11
Description: Domain of unknown function (DUF758)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.3e-76  242.0   0.1    2.6e-76  241.8   0.1    1.0  1  XP_013852617.1  


Domain annotation for each sequence (and alignments):
>> XP_013852617.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  241.8   0.1   2.6e-76   2.6e-76       1     181 []      19     197 ..      19     197 .. 0.99

  Alignments for each domain:
  == domain 1  score: 241.8 bits;  conditional E-value: 2.6e-76
          DUF758   1 FsskdlalraqKkllgkmasksvaklfiddtsselldelykllkeytgnkkeaekvvKniiKvvvKvgvllrnkqlsaeelallekfrkklrtla 95 
                     Fssk+lal+a+Kkll+kma++sv++lfid+tsse+ldely+++keyt+++ +a++v+K++iKv++Kv+vl+r++++s++elal+++fr+klr+ a
  XP_013852617.1  19 FSSKSLALQAEKKLLSKMAGRSVVHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRSGCFSPSELALATRFRQKLRQGA 113
                     99********************************************************************************************* PP

          DUF758  96 mtlisfyevdftfdkavLadlLkecrellkqlverhLtdkslgridhvfdflsdpefldalfspdseyrellkkivddLnklldeg 181
                     mt++sf evdftf++avLa+lL+ecr++l++lv++hLt+ks+gri+hvfd++sd  +l+al+ pd  + + l+ki+d+L+klldeg
  XP_013852617.1 114 MTVLSFSEVDFTFEAAVLASLLTECRDMLLELVAQHLTPKSHGRIRHVFDHFSDLGLLTALYGPD--FTSRLGKICDGLRKLLDEG 197
                     **************************************************************666..*****************97 PP



Or compare XP_013852617.1 to CDD or PaperBLAST