PaperBLAST – Find papers about a protein or its homologs

 

Align XP_016877658.1 to PF05527 (DUF758)

XP_016877658.1 has 158 amino acids

Query:       DUF758  [M=181]
Accession:   PF05527.11
Description: Domain of unknown function (DUF758)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    4.6e-70  221.4   5.5    5.1e-70  221.3   5.5    1.0  1  XP_016877658.1  


Domain annotation for each sequence (and alignments):
>> XP_016877658.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  221.3   5.5   5.1e-70   5.1e-70      26     180 ..       1     155 [.       1     156 [. 0.99

  Alignments for each domain:
  == domain 1  score: 221.3 bits;  conditional E-value: 5.1e-70
          DUF758  26 lfiddtsselldelykllkeytgnkkeaekvvKniiKvvvKvgvllrnkqlsaeelallekfrkklrtlamtlisfyevdftfdkavLadlLkec 120
                     ++iddtsse++delyk++ke+t+nkkea+k++K++iKv++K+g+l+rn+q+s+eel  +ekfrkkl+++amt++sfyev++tfd++vL++lL+ec
  XP_016877658.1   1 MLIDDTSSEIFDELYKVTKEHTHNKKEAHKIMKDLIKVAIKIGILYRNNQFSQEELVIVEKFRKKLNQTAMTIVSFYEVEYTFDRNVLSNLLHEC 95 
                     79********************************************************************************************* PP

          DUF758 121 rellkqlverhLtdkslgridhvfdflsdpefldalfspdseyrellkkivddLnkllde 180
                     ++l+++lv+rhLt++++gri+hvf++++d efl++l+s d+++r++lk+i++++nkllde
  XP_016877658.1  96 KDLVHELVQRHLTPRTHGRINHVFNHFADVEFLSTLYSLDGDCRPNLKRICEGINKLLDE 155
                     ***********************************************************8 PP



Or compare XP_016877658.1 to CDD or PaperBLAST