PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001295112.1 to PF05600 (DUF773)

NP_001295112.1 has 392 amino acids

Query:       DUF773  [M=508]
Accession:   PF05600.12
Description: CDK5 regulatory subunit-associated protein 3
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
   6.9e-134  433.3   0.9   7.7e-134  433.2   0.9    1.0  1  NP_001295112.1  


Domain annotation for each sequence (and alignments):
>> NP_001295112.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  433.2   0.9  7.7e-134  7.7e-134     111     508 .]       2     389 ..       1     389 [. 0.95

  Alignments for each domain:
  == domain 1  score: 433.2 bits;  conditional E-value: 7.7e-134
          DUF773 111 EaAqiLvrnvnYeiPalkkqiaklqqqleelerKeadlkrsaaeaaakyeeackqlgikGenvreeLlelvkeLpslfekiveslkseklskaie 205
                     E++++Lvrnv+YeiP+lkkqiak+qq+++e++rKe++ +  aae++++++++ckq+gi+G+nvr+eLl+lvk+Lps +++i + ++s  l +ai+
  NP_001295112.1   2 ELCSLLVRNVSYEIPSLKKQIAKCQQLQQEYSRKEEEGQAGAAEMREQFYHSCKQYGITGDNVRRELLALVKDLPSQLAEIGAGAQS--LGEAID 94 
                     99*************************************************************************************..****** PP

          DUF773 206 yYsafvsfvnkeskkesevlpllkeviekgnttvyewrtgeapskveeaeeevqeeeeeaeeeeekeIDwg..........dgeeeaaeIdwdsa 290
                     +Y+a+v+fv+++    ++vlp+l++v++kgn tvyewrtg++ps+ve+++ e+  e+  +e+    eIDwg          ++ +e+ +Idw+  
  NP_001295112.1  95 LYQACVEFVCDS--PTEQVLPMLRYVQKKGNSTVYEWRTGTEPSVVERPQLEEPPEQV-QED----EIDWGdfgveavsdsGIVAETPGIDWG-- 180
                     ************..889********************************994444433.333....7*************988899*******.. PP

          DUF773 291 ekeeedavaeeeeaeIdwgdseeaevdisveesgedseeevsaaaegvakgeealsllddteyRnkllddLlELeaFLkqRlvElsnestsvlsl 385
                      + e +++++  +++Idwgd  +a+ +i+v e+g++       a+egva+g++al+ll+ +e+Rn+++d+L+ELe+FL+qR+vE+s+e+ ++ls+
  NP_001295112.1 181 ISLE-SEAKDAGADKIDWGDDAAAASEITVLETGTE-------APEGVARGSDALTLLEYPETRNQFIDELMELEIFLSQRAVEMSEEA-DILSV 266
                     2232.3345678899*******************98.......799******************************************8.***** PP

          DUF773 386 qqfqsapevlqsqtkeeiekmlsaveealslltnkklqqLiliktspryvdrlvasLeqklkqeeklkeklkdleekreelqeelselepklekl 480
                     +qfq ap +lq qtke++ +++s+ ++++ +lt+ ++q+L++i++spryvdr+++ L+qklkq + l  k++ + ek++e+ +e+++lepkl+ l
  NP_001295112.1 267 SQFQLAPAILQGQTKEKMLSLVSTLQQLIGRLTSLRMQHLFMILASPRYVDRVTEFLQQKLKQSQLLALKKELMVEKQQEALQEQAALEPKLDLL 361
                     *********************************************************************************************** PP

          DUF773 481 vkktrelkkliekelSkrykgrpVnlmG 508
                     ++ktrel+klie+++Skry+grpVnlmG
  NP_001295112.1 362 LEKTRELQKLIEADISKRYSGRPVNLMG 389
                     ***************************9 PP



Or compare NP_001295112.1 to CDD or PaperBLAST