PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q96JB5 to PF05600 (DUF773)

SwissProt::Q96JB5 has 506 amino acids

Query:       DUF773  [M=508]
Accession:   PF05600.12
Description: CDK5 regulatory subunit-associated protein 3
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
   4.6e-195  635.2   0.8   5.2e-195  635.0   0.8    1.0  1  SwissProt::Q96JB5  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q96JB5  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  635.0   0.8  5.2e-195  5.2e-195       2     508 .]       5     503 ..       4     503 .. 0.97

  Alignments for each domain:
  == domain 1  score: 635.0 bits;  conditional E-value: 5.2e-195
             DUF773   2 qnlpIDIqyskLldWLvdRrhvpkdWqkqlkairekIseaiqdlpkeseeilqllsgeeinYfhckkIveiLketeassknlFGryssqrmk 93 
                        q++pIDIq+skLldWLvdRrh++ +Wq+ + +irekI++aiqd+p eseei qllsg++i+Yfhc++I+++Lk teas+kn+FGryssqrmk
  SwissProt::Q96JB5   5 QHVPIDIQTSKLLDWLVDRRHCSLKWQSLVLTIREKINAAIQDMP-ESEEIAQLLSGSYIHYFHCLRILDLLKGTEASTKNIFGRYSSQRMK 95 
                        789******************************************.99******************************************** PP

             DUF773  94 dWqeivklYekdnvyLaEaAqiLvrnvnYeiPalkkqiaklqqqleelerKeadlkrsaaeaaakyeeackqlgikGenvreeLlelvkeLp 185
                        dWqei+ lYekdn+yL E++++LvrnvnYeiP+lkkqiak+qq+++e++rKe++++  aae++++++++ckq+gi+Genvr eLl+lvk+Lp
  SwissProt::Q96JB5  96 DWQEIIALYEKDNTYLVELSSLLVRNVNYEIPSLKKQIAKCQQLQQEYSRKEEECQAGAAEMREQFYHSCKQYGITGENVRGELLALVKDLP 187
                        ******************************************************************************************** PP

             DUF773 186 slfekiveslkseklskaieyYsafvsfvnkeskkesevlpllkeviekgnttvyewrtgeapskveeaeeevqeeeeeaeeeeekeIDwg. 276
                        s +++i +++++ +l +ai+ Y+a v fv+++    ++vlp+l++v+++gn tvyewrtg++ps+ve+++ e+  e+ + e+     IDwg 
  SwissProt::Q96JB5 188 SQLAEIGAAAQQ-SLGEAIDVYQASVGFVCES--PTEQVLPMLRFVQKRGNSTVYEWRTGTEPSVVERPHLEELPEQVA-ED----AIDWGd 271
                        ***********9.******************9..889********************************9955444433.33....7***** PP

             DUF773 277 ............dgeeeaaeIdwdsaekeeedavaeeeeaeIdwgdseeaevdisveesgedseeevsaaaegvakgeealsllddteyRnk 356
                                    ++++eaa+Idw+      e++ ++  +++Idwgd ++ +++i+v e+g++       a+egva+g +al+ll+ te+Rn+
  SwissProt::Q96JB5 272 fgveavsegtdsGISAEAAGIDWG---IFPESDSKDPGGDGIDWGD-DAVALQITVLEAGTQ-------APEGVARGPDALTLLEYTETRNQ 352
                        ************999*********...555666678999*******.9999*********98.......799******************** PP

             DUF773 357 llddLlELeaFLkqRlvElsnestsvlslqqfqsapevlqsqtkeeiekmlsaveealslltnkklqqLiliktspryvdrlvasLeqklkq 448
                        +ld+L+ELe+FL+qR+vEls+e+ +vls++qfq ap +lq qtke++ +m+s  e+++ +lt+ +lq+L++i++spryvdr+++ L+qklkq
  SwissProt::Q96JB5 353 FLDELMELEIFLAQRAVELSEEA-DVLSVSQFQLAPAILQGQTKEKMVTMVSVLEDLIGKLTSLQLQHLFMILASPRYVDRVTEFLQQKLKQ 443
                        **********************8.******************************************************************** PP

             DUF773 449 eeklkeklkdleekreelqeelselepkleklvkktrelkkliekelSkrykgrpVnlmG 508
                         + l  k++ + +k++e+ ee+++lepkl+ l++kt+el+klie+++Skry+grpVnlmG
  SwissProt::Q96JB5 444 SQLLALKKELMVQKQQEALEEQAALEPKLDLLLEKTKELQKLIEADISKRYSGRPVNLMG 503
                        ***********************************************************9 PP



Or compare SwissProt::Q96JB5 to CDD or PaperBLAST