PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q99LM2 to PF05600 (DUF773)

SwissProt::Q99LM2 has 503 amino acids

Query:       DUF773  [M=508]
Accession:   PF05600.12
Description: CDK5 regulatory subunit-associated protein 3
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
   1.5e-196  640.0   3.7   1.7e-196  639.8   3.7    1.0  1  SwissProt::Q99LM2  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q99LM2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  639.8   3.7  1.7e-196  1.7e-196       2     508 .]       5     500 ..       4     500 .. 0.96

  Alignments for each domain:
  == domain 1  score: 639.8 bits;  conditional E-value: 1.7e-196
             DUF773   2 qnlpIDIqyskLldWLvdRrhvpkdWqkqlkairekIseaiqdlpkeseeilqllsgeeinYfhckkIveiLketeassknlFGryssqrmk 93 
                        q++pIDIq+skLldWLvdRrh++ +Wq+ + +irekI++aiqd+p es+ei qllsg++i+Yfhc++Iv++Lk teas+kn+FGryssqrmk
  SwissProt::Q99LM2   5 QHVPIDIQTSKLLDWLVDRRHCNLKWQSLVLTIREKINTAIQDMP-ESQEIAQLLSGSYIHYFHCLRIVDLLKGTEASTKNIFGRYSSQRMK 95 
                        789******************************************.99******************************************** PP

             DUF773  94 dWqeivklYekdnvyLaEaAqiLvrnvnYeiPalkkqiaklqqqleelerKeadlkrsaaeaaakyeeackqlgikGenvreeLlelvkeLp 185
                        dWqeiv+lYekdn+yL E++++Lvrnv+YeiP+lkkqiak+qq+++e++rKe++ +  aae++++++++ckq+gi+G+nvr+eLl+lvk+Lp
  SwissProt::Q99LM2  96 DWQEIVSLYEKDNTYLVELCSLLVRNVSYEIPSLKKQIAKCQQLQQEYSRKEEEGQAGAAEMREQFYHSCKQYGITGDNVRRELLALVKDLP 187
                        ******************************************************************************************** PP

             DUF773 186 slfekiveslkseklskaieyYsafvsfvnkeskkesevlpllkeviekgnttvyewrtgeapskveeaeeevqeeeeeaeeeeekeIDwg. 276
                        s +++i + ++s  l +ai++Y+a+v+fv+++    ++vlp+l++v++kgn tvyewrtg++ps+ve+++ e+  e+  +e+    eIDwg 
  SwissProt::Q99LM2 188 SQLAEIGAGAQS--LGEAIDLYQACVEFVCDS--PTEQVLPMLRYVQKKGNSTVYEWRTGTEPSVVERPQLEEPPEQV-QED----EIDWGd 270
                        ************..******************..889********************************994444433.333....7***** PP

             DUF773 277 .........dgeeeaaeIdwdsaekeeedavaeeeeaeIdwgdseeaevdisveesgedseeevsaaaegvakgeealsllddteyRnklld 359
                                 ++ +e+ +Idw+   + e +++++  +++Idwgd  +a+ +i+v e+g++       a+egva+g++al+ll+ +e+Rn+++d
  SwissProt::Q99LM2 271 fgveavsdsGIVAETPGIDWG--ISLE-SEAKDAGADKIDWGDDAAAASEITVLETGTE-------APEGVARGSDALTLLEYPETRNQFID 352
                        ********988899*******..2232.3345678899*******************98.......799*********************** PP

             DUF773 360 dLlELeaFLkqRlvElsnestsvlslqqfqsapevlqsqtkeeiekmlsaveealslltnkklqqLiliktspryvdrlvasLeqklkqeek 451
                        +L+ELe+FL+qR+vE+s+e+ ++ls++qfq ap +lq qtke++ +++s+ ++++ +lt+ ++q+L++i++spryvdr+++ L+qklkq + 
  SwissProt::Q99LM2 353 ELMELEIFLSQRAVEMSEEA-DILSVSQFQLAPAILQGQTKEKMLSLVSTLQQLIGRLTSLRMQHLFMILASPRYVDRVTEFLQQKLKQSQL 443
                        *******************8.*********************************************************************** PP

             DUF773 452 lkeklkdleekreelqeelselepkleklvkktrelkkliekelSkrykgrpVnlmG 508
                        l  k++ + ek++e+ +e+++lepkl+ l++ktrel+klie+++Skry+grpVnlmG
  SwissProt::Q99LM2 444 LALKKELMVEKQQEALQEQAALEPKLDLLLEKTRELQKLIEADISKRYSGRPVNLMG 500
                        ********************************************************9 PP



Or compare SwissProt::Q99LM2 to CDD or PaperBLAST