PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q9JLH7 to PF05600 (DUF773)

SwissProt::Q9JLH7 has 504 amino acids

Query:       DUF773  [M=508]
Accession:   PF05600.12
Description: CDK5 regulatory subunit-associated protein 3
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
   1.2e-193  630.5   3.2   1.3e-193  630.3   3.2    1.0  1  SwissProt::Q9JLH7  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q9JLH7  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  630.3   3.2  1.3e-193  1.3e-193       2     508 .]       5     501 ..       4     501 .. 0.96

  Alignments for each domain:
  == domain 1  score: 630.3 bits;  conditional E-value: 1.3e-193
             DUF773   2 qnlpIDIqyskLldWLvdRrhvpkdWqkqlkairekIseaiqdlpkeseeilqllsgeeinYfhckkIveiLketeassknlFGryssqrmk 93 
                        q++pIDIq+skLldWLvdRrh++ +Wq+ + +irekI++aiqd+p es+ei qllsg++i+Yfhc++Iv++Lk teas+kn+FGryssqrmk
  SwissProt::Q9JLH7   5 QHVPIDIQTSKLLDWLVDRRHCNLKWQSLVLTIREKINTAIQDMP-ESQEIAQLLSGSYIHYFHCLRIVDLLKGTEASTKNIFGRYSSQRMK 95 
                        789******************************************.99******************************************** PP

             DUF773  94 dWqeivklYekdnvyLaEaAqiLvrnvnYeiPalkkqiaklqqqleelerKeadlkrsaaeaaakyeeackqlgikGenvreeLlelvkeLp 185
                        dWqei++lYekdn+yL E++++LvrnvnYeiP+lkkqiak+qq++++++rKe++ +  aae++++++++ckq+gi+G+nvr+eLl+lvk+Lp
  SwissProt::Q9JLH7  96 DWQEIISLYEKDNTYLVELSSLLVRNVNYEIPSLKKQIAKCQQLQQDYSRKEEEGQAGAAEMREQFYHSCKQYGITGDNVRRELLALVKDLP 187
                        ******************************************************************************************** PP

             DUF773 186 slfekiveslkseklskaieyYsafvsfvnkeskkesevlpllkeviekgnttvyewrtgeapskveeaeeevqeeeeeaeeeeekeIDwg. 276
                        s +++i + ++s  l +ai++Y+a+v+fv+++    ++vlp+l++v+ kgn tvyewrtg++ps+ve+++ e +  e+ +e+    eIDwg 
  SwissProt::Q9JLH7 188 SQLAEIGAGAQS--LGEAIDLYQACVEFVCDS--PTEQVLPMLRYVQPKGNSTVYEWRTGTEPSVVERPQLE-DPPEQVQED----EIDWGd 270
                        ************..******************..889*******************************9994.444444444....7***** PP

             DUF773 277 ...........dgeeeaaeIdwdsaekeeedavaeeeeaeIdwgdseeaevdisveesgedseeevsaaaegvakgeealsllddteyRnkl 357
                                    +++e+ +Idw+   + e ++ ++  +++Idwgd ++ + +i+v e+g++       a+egva+g++al+ll+ +e+Rn++
  SwissProt::Q9JLH7 271 fgleavsdsgnIISAETPGIDWG--ISLE-SESKDAGADKIDWGD-NAVASEITVLETGTE-------APEGVARGSDALTLLEYPETRNQF 351
                        *********9977899*******..2222.3335678899*****.99999*******998.......799********************* PP

             DUF773 358 lddLlELeaFLkqRlvElsnestsvlslqqfqsapevlqsqtkeeiekmlsaveealslltnkklqqLiliktspryvdrlvasLeqklkqe 449
                        +d+L+ELe+FL+qR+vE+s+e+ ++ls++qfq ap +lq qtke++ +++s+ ++++ +lt+  lq+L++i++spryvdr+++ L+qklkq 
  SwissProt::Q9JLH7 352 IDELMELEIFLSQRAVEMSEEA-DILSVSQFQLAPAILQGQTKEKMLSLVSTLQHLIGQLTSLDLQHLFMILASPRYVDRVTELLQQKLKQS 442
                        *********************8.********************************************************************* PP

             DUF773 450 eklkeklkdleekreelqeelselepkleklvkktrelkkliekelSkrykgrpVnlmG 508
                        + l  k+  + ek++e+ +e+++lepkl+ l++ktrel+klie+++Skry+grpVnlmG
  SwissProt::Q9JLH7 443 QLLALKKDLMVEKQQEALQEQAALEPKLDLLLEKTRELQKLIEADISKRYNGRPVNLMG 501
                        **********************************************************9 PP



Or compare SwissProt::Q9JLH7 to CDD or PaperBLAST