PaperBLAST – Find papers about a protein or its homologs

 

Align XP_011523599.1 to PF05600 (DUF773)

XP_011523599.1 has 531 amino acids

Query:       DUF773  [M=508]
Accession:   PF05600.12
Description: CDK5 regulatory subunit-associated protein 3
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
   5.5e-195  634.9   0.8   6.2e-195  634.7   0.8    1.0  1  XP_011523599.1  


Domain annotation for each sequence (and alignments):
>> XP_011523599.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  634.7   0.8  6.2e-195  6.2e-195       2     508 .]      30     528 ..      29     528 .. 0.97

  Alignments for each domain:
  == domain 1  score: 634.7 bits;  conditional E-value: 6.2e-195
          DUF773   2 qnlpIDIqyskLldWLvdRrhvpkdWqkqlkairekIseaiqdlpkeseeilqllsgeeinYfhckkIveiLketeassknlFGryssqrmkdWq 96 
                     q++pIDIq+skLldWLvdRrh++ +Wq+ + +irekI++aiqd+p eseei qllsg++i+Yfhc++I+++Lk teas+kn+FGryssqrmkdWq
  XP_011523599.1  30 QHVPIDIQTSKLLDWLVDRRHCSLKWQSLVLTIREKINAAIQDMP-ESEEIAQLLSGSYIHYFHCLRILDLLKGTEASTKNIFGRYSSQRMKDWQ 123
                     789******************************************.99*********************************************** PP

          DUF773  97 eivklYekdnvyLaEaAqiLvrnvnYeiPalkkqiaklqqqleelerKeadlkrsaaeaaakyeeackqlgikGenvreeLlelvkeLpslfeki 191
                     ei+ lYekdn+yL E++++LvrnvnYeiP+lkkqiak+qq+++e++rKe++++  aae++++++++ckq+gi+Genvr eLl+lvk+Lps +++i
  XP_011523599.1 124 EIIALYEKDNTYLVELSSLLVRNVNYEIPSLKKQIAKCQQLQQEYSRKEEECQAGAAEMREQFYHSCKQYGITGENVRGELLALVKDLPSQLAEI 218
                     *********************************************************************************************** PP

          DUF773 192 veslkseklskaieyYsafvsfvnkeskkesevlpllkeviekgnttvyewrtgeapskveeaeeevqeeeeeaeeeeekeIDwg.......... 276
                      +++++ +l +ai+ Y+a v fv+++    ++vlp+l++v+++gn tvyewrtg++ps+ve+++ e+  e+ + e+     IDwg          
  XP_011523599.1 219 GAAAQQ-SLGEAIDVYQASVGFVCES--PTEQVLPMLRFVQKRGNSTVYEWRTGTEPSVVERPHLEELPEQVA-ED----AIDWGdfgveavseg 305
                     *****9.******************9..889********************************9955444433.33....7************** PP

          DUF773 277 ...dgeeeaaeIdwdsaekeeedavaeeeeaeIdwgdseeaevdisveesgedseeevsaaaegvakgeealsllddteyRnkllddLlELeaFL 368
                        ++++eaa+Idw+      e++ ++  +++Idwgd ++ +++i+v e+g++       a+egva+g +al+ll+ te+Rn++ld+L+ELe+FL
  XP_011523599.1 306 tdsGISAEAAGIDWG---IFPESDSKDPGGDGIDWGD-DAVALQITVLEAGTQ-------APEGVARGPDALTLLEYTETRNQFLDELMELEIFL 389
                     ***999*********...555666678999*******.9999*********98.......799******************************** PP

          DUF773 369 kqRlvElsnestsvlslqqfqsapevlqsqtkeeiekmlsaveealslltnkklqqLiliktspryvdrlvasLeqklkqeeklkeklkdleekr 463
                     +qR+vEls+e+ +vls++qfq ap +lq qtke++ +m+s  e+++ +lt+ +lq+L++i++spryvdr+++ L+qklkq + l  k++ + +k+
  XP_011523599.1 390 AQRAVELSEEA-DVLSVSQFQLAPAILQGQTKEKMVTMVSVLEDLIGKLTSLQLQHLFMILASPRYVDRVTEFLQQKLKQSQLLALKKELMVQKQ 483
                     **********8.*********************************************************************************** PP

          DUF773 464 eelqeelselepkleklvkktrelkkliekelSkrykgrpVnlmG 508
                     +e+ ee+++lepkl+ l++kt+el+klie+++Skry+grpVnlmG
  XP_011523599.1 484 QEALEEQAALEPKLDLLLEKTKELQKLIEADISKRYSGRPVNLMG 528
                     ********************************************9 PP



Or compare XP_011523599.1 to CDD or PaperBLAST