PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS6585980 to PF05603 (DUF775)

VIMSS6585980 has 246 amino acids

Query:       DUF775  [M=199]
Accession:   PF05603.12
Description: Protein of unknown function (DUF775)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.2e-67  213.4   0.0    1.4e-67  213.2   0.0    1.0  1  VIMSS6585980  


Domain annotation for each sequence (and alignments):
>> VIMSS6585980  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  213.2   0.0   1.4e-67   1.4e-67       1     199 []       1     240 [.       1     240 [. 0.95

  Alignments for each domain:
  == domain 1  score: 213.2 bits;  conditional E-value: 1.4e-67
        DUF775   1 mFgvivagrpvqtelqqvse....tkfvfslpkaksishivvFllpnvtlpegtaaavYlqlpekeefklLGalsneKpSAifkvknekss...... 87 
                   mF++i++g+p+q++++++++    +++v+s +k+k +shi++F+lpnvt+p+++ a+vY++l+++eefkl+G+ls+eKpSAifkv+ ++s+      
  VIMSS6585980   1 MFAAIASGNPLQLSVEVPNSnglqHTIVLSRTKPKLYSHITLFILPNVTFPQDYIATVYFKLSPQEEFKLFGYLSSEKPSAIFKVQIPSSKkdagdt 97 
                   9******************999999****************************************************************999***** PP

        DUF775  88 .................seaesaseassaeesstltiGisiEpleqvaaqlaelkaeqsassssaassskseessaav................tke 151
                                    ++  ++++ ss+++ s+l+iGisiEp+eq + +l+e+ka+ +a++++++s   s+++                    t+e
  VIMSS6585980  98 sdglgeidmdvddgsgaADPFTDTNGSSSNNISELIIGISIEPREQGMMKLEEWKASMNAEAQKNNSLILSRPNLGIIrnittagqlaqvypslTQE 194
                   **************99866667788888*******************************9999888877777665544899**************** PP

        DUF775 152 laqkiiknafnylaSFadkageevvplkafekWwekFerklendpnFl 199
                   la+ki+++a+nyl++F+d  ++++vp+k+f++Ww+kF+++l+nd +Fl
  VIMSS6585980 195 LAAKIVQHAYNYLSGFLD--AQGNVPIKRFDTWWDKFRNRLANDGTFL 240
                   ******************..***************************8 PP



Or compare VIMSS6585980 to CDD or PaperBLAST