PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS17179 to PF05656 (DUF805)

VIMSS17179 has 118 amino acids

Query:       DUF805  [M=105]
Accession:   PF05656.14
Description: Protein of unknown function (DUF805)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    2.3e-37  113.9   2.3    2.6e-37  113.7   2.3    1.0  1  VIMSS17179  


Domain annotation for each sequence (and alignments):
>> VIMSS17179  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  113.7   2.3   2.6e-37   2.6e-37       1     105 []      11     113 ..      11     113 .. 0.98

  Alignments for each domain:
  == domain 1  score: 113.7 bits;  conditional E-value: 2.6e-37
      DUF805   1 yfdfkGRasRsefwwfvlfllllvivlallaavlaaaavasalsvvlallllvpslavtvRRlHDtgrsgwllllllvplialllllvllllpgtpgen 99 
                 y+ f+GRa+R+e+w+f+l+++++ ++++++  +l        ls++++l++++p la+++RRlHDt+rsg ++ll++vp+i++l+llv+++ +gt+g+n
  VIMSS17179  11 YVGFSGRARRKEYWMFTLINAIVGAIINVIQLIL--GLELPYLSMLYLLATFLPVLALAIRRLHDTDRSGAWALLFFVPFIGWLVLLVFFCTEGTSGSN 107
                 789*****************************99..788999********************************************************* PP

      DUF805 100 ryGpdp 105
                 ryG+dp
  VIMSS17179 108 RYGNDP 113
                 ****98 PP



Or compare VIMSS17179 to CDD or PaperBLAST