PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS359307 to PF05656 (DUF805)

VIMSS359307 has 120 amino acids

Query:       DUF805  [M=105]
Accession:   PF05656.14
Description: Protein of unknown function (DUF805)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
      3e-33  100.7   2.0    3.4e-33  100.5   2.0    1.0  1  VIMSS359307  


Domain annotation for each sequence (and alignments):
>> VIMSS359307  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  100.5   2.0   3.4e-33   3.4e-33       1     105 []      11     112 ..      11     112 .. 0.96

  Alignments for each domain:
  == domain 1  score: 100.5 bits;  conditional E-value: 3.4e-33
       DUF805   1 yfdfkGRasRsefwwfvlfllllvivlallaavlaaaavasalsvvlallllvpslavtvRRlHDtgrsgwllllllvplialllllvllllpgtpge 98 
                  y +f+GRa+R+e+w+f l +++++ +l +l+++    ++ ++++++++l++++ps++v +RRlHD+g++gw+ ll +vp+ + ++llv++++++++++
  VIMSS359307  11 YGNFSGRATRKEYWIFSLSNIVIFWLLLFLSSFS--EVLVAIIALLFMLVMIIPSFSVGARRLHDIGKTGWWQLLNFVPF-GSVVLLVFFIIESEEND 105
                  569****************************998..789999*************************************7.6699************* PP

       DUF805  99 nryGpdp 105
                   +yGp+p
  VIMSS359307 106 HQYGPNP 112
                  *****97 PP



Or compare VIMSS359307 to CDD or PaperBLAST