PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS3630569 to PF05656 (DUF805)

VIMSS3630569 has 137 amino acids

Query:       DUF805  [M=105]
Accession:   PF05656.14
Description: Protein of unknown function (DUF805)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    3.8e-20   58.6   1.0    2.8e-19   55.8   0.0    2.0  2  VIMSS3630569  


Domain annotation for each sequence (and alignments):
>> VIMSS3630569  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   55.8   0.0   2.8e-19   2.8e-19      43     104 ..      22      83 ..       2      84 .. 0.87
   2 ?    1.8   0.2     0.018     0.018      72      90 ..      95     113 ..      88     132 .. 0.53

  Alignments for each domain:
  == domain 1  score: 55.8 bits;  conditional E-value: 2.8e-19
        DUF805  43 lsvvlallllvpslavtvRRlHDtgrsgwllllllvplialllllvllllpgtpgenryGpd 104
                    + +l ++ +++++ +t+RRlHD++ +gwl ll+lvp++++ l ++l++ +gt+g+n yGp+
  VIMSS3630569  22 CIAILYIVGIYINFVFTIRRLHDRNNTGWLSLLMLVPVVNIGLAIYLFCAKGTEGPNDYGPK 83 
                   4556667777788***************************99******************96 PP

  == domain 2  score: 1.8 bits;  conditional E-value: 0.018
        DUF805  72 llllllvplialllllvll 90 
                   ++ ++l+pl  ++ ++ ++
  VIMSS3630569  95 WIYIALIPLALIFGVIAVI 113
                   3455555533222222222 PP



Or compare VIMSS3630569 to CDD or PaperBLAST