PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS57110 to PF05656 (DUF805)

VIMSS57110 has 358 amino acids

Query:       DUF805  [M=105]
Accession:   PF05656.14
Description: Protein of unknown function (DUF805)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    3.3e-25   74.8   4.7    3.3e-25   74.8   4.7    1.7  2  VIMSS57110  


Domain annotation for each sequence (and alignments):
>> VIMSS57110  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   74.8   4.7   3.3e-25   3.3e-25       2     105 .]     175     277 ..     174     277 .. 0.91
   2 ?   -1.8   0.0      0.23      0.23      73      89 ..     289     305 ..     280     318 .. 0.51

  Alignments for each domain:
  == domain 1  score: 74.8 bits;  conditional E-value: 3.3e-25
      DUF805   2 fdfkGRasRsefwwfvlfllllvivlallaavlaaaavasalsvvlallllvpslavtvRRlHDtgrsgwllllllvplialllllvllllpgtpgenr 100
                 f+ +GR++R ++  + ++++l+++v++ l  +l + +v+ a++ + +++++v+++++ v+RlHD+g+sgwl+ll +vp+++ ++ +++l+lpg+ g+nr
  VIMSS57110 175 FTTNGRIGRLRYLGWSMAMTLCFLVIMGLGFLL-GETVGVAVTALASIAFIVIAVMIGVQRLHDLGWSGWLWLLNFVPFVGSVFGILMLVLPGSTGANR 272
                 899*********988888888777766666655.57899999********************************************************* PP

      DUF805 101 yGpdp 105
                 yGp+p
  VIMSS57110 273 YGPPP 277
                 ***97 PP

  == domain 2  score: -1.8 bits;  conditional E-value: 0.23
      DUF805  73 lllllvplialllllvl 89 
                  l++l+p++++++ + l
  VIMSS57110 289 SLIILLPIVGIIAAIAL 305
                 34444455554444433 PP



Or compare VIMSS57110 to CDD or PaperBLAST