PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::P0A8Z7 to PF05728 (UPF0227)

SwissProt::P0A8Z7 has 193 amino acids

Query:       UPF0227  [M=187]
Accession:   PF05728.12
Description: Uncharacterised protein family (UPF0227)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
      1e-78  249.7   0.0    1.2e-78  249.5   0.0    1.0  1  SwissProt::P0A8Z7  


Domain annotation for each sequence (and alignments):
>> SwissProt::P0A8Z7  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  249.5   0.0   1.2e-78   1.2e-78       2     186 ..       4     188 ..       3     189 .. 0.99

  Alignments for each domain:
  == domain 1  score: 249.5 bits;  conditional E-value: 1.2e-78
            UPF0227   2 llYlHGFdSSPlshkaqllsqfiaedvlaielsvlklkedpqqalkeleklvaelgddnillvGssLGGyyatrlgerfglrqvllnPalkp 93 
                        llYlHGF+SSP+s+ka+ll++++ae+++++e+++++l+ +p++a++ le++v e+g d++++vGssLGGyyat+l+++f+l +v++nPa++p
  SwissProt::P0A8Z7   4 LLYLHGFNSSPRSAKASLLKNWLAEHHPDVEMIIPQLPPYPSDAAELLESIVLEHGGDSLGIVGSSLGGYYATWLSQCFMLPAVVVNPAVRP 95 
                        89****************************************************************************************** PP

            UPF0227  94 lenlagklgeeavqstqetyvleeyhiielkalelsrlkrperilvllskqDevldyrravaefraaaeiveddgdHafkdvsehlqqiiaf 185
                        +e l+++lg++++++t+++yvle++hi++lk+++++ l++p+ i++l++++Devldyr+ava++++++++v+++g+Haf++++++++ i++f
  SwissProt::P0A8Z7  96 FELLTDYLGQNENPYTGQQYVLESRHIYDLKVMQIDPLEAPDLIWLLQQTGDEVLDYRQAVAYYASCRQTVIEGGNHAFTGFEDYFNPIVDF 187
                        *******************************************************************************************9 PP

            UPF0227 186 l 186
                        l
  SwissProt::P0A8Z7 188 L 188
                        7 PP



Or compare SwissProt::P0A8Z7 to CDD or PaperBLAST