PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1745207 to PF05728 (UPF0227)

VIMSS1745207 has 399 amino acids

Query:       UPF0227  [M=187]
Accession:   PF05728.12
Description: Uncharacterised protein family (UPF0227)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    2.5e-09   23.5   0.0    7.7e-09   21.9   0.0    1.7  2  VIMSS1745207  


Domain annotation for each sequence (and alignments):
>> VIMSS1745207  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.0   0.0      0.17      0.17       5      13 ..     174     182 ..     171     186 .. 0.85
   2 !   21.9   0.0   7.7e-09   7.7e-09      44     160 ..     238     364 ..     231     393 .. 0.73

  Alignments for each domain:
  == domain 1  score: -2.0 bits;  conditional E-value: 0.17
       UPF0227   5 lHGFdSSPl 13 
                   +HGF  SP 
  VIMSS1745207 174 IHGFMGSPY 182
                   8******95 PP

  == domain 2  score: 21.9 bits;  conditional E-value: 7.7e-09
       UPF0227  44 qalkeleklvae...lgddnillvGssLGGyyatrlger.fglrqvlln.Palkplenlagklgeeavqstqetyvleeyhiielka.....lelsr 130
                   qa++   +++ +   +g d+i+l G sLGG++++ l+   + +++v+ n P ++p++++++   ++ +   + ++  +  ++ e +a     l+ + 
  VIMSS1745207 238 QAVHDFRSVMDHlefTGVDRIALTGISLGGFTSALLASVdHRIQAVIPNvPVVTPDRTVDEWFPANMLVALERHIAHTDPELTEAAAryaspLHYQP 334
                   55554444443300045677****************97539999999988**********9999998888887777666665555442222266666 PP

       UPF0227 131 lkrperilvllskqDevldyrravaefraa 160
                   l ++er l++ + +D   + ++a   ++++
  VIMSS1745207 335 LVAKERRLIITGLGDRLAPPQQAELLWEHW 364
                   999999999999999999988887666666 PP



Or compare VIMSS1745207 to CDD or PaperBLAST