PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS202985 to PF05728 (UPF0227)

VIMSS202985 has 191 amino acids

Query:       UPF0227  [M=187]
Accession:   PF05728.12
Description: Uncharacterised protein family (UPF0227)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.4e-62  196.4   0.1    2.7e-62  196.2   0.1    1.0  1  VIMSS202985  


Domain annotation for each sequence (and alignments):
>> VIMSS202985  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  196.2   0.1   2.7e-62   2.7e-62       1     186 [.       1     188 [.       1     189 [. 0.98

  Alignments for each domain:
  == domain 1  score: 196.2 bits;  conditional E-value: 2.7e-62
      UPF0227   1 kllYlHGFdSSPlshkaqllsqfiaedvlaielsvlklkedpqqalkeleklvaelgddn..illvGssLGGyyatrlgerfglrqvllnPalkplen 96 
                  +llY+HGF+SSP s ka+   +++ae ++ +++  ++l++ p+ a++ l++ v++ ++ n  +  +GssLGGy+a +l+er+g r+vl+nPa+kp+e 
  VIMSS202985   1 MLLYIHGFNSSPFSDKAVITARYMAEYHPSLTFHQPQLPNTPKAAMALLQSYVEAAQQANepLNYIGSSLGGYFASYLAERYGGRAVLVNPAVKPFEL 98 
                  79****************************************************99999888899********************************* PP

      UPF0227  97 lagklgeeavqstqetyvleeyhiielkalelsrlkrperilvllskqDevldyrravaefraaaeiveddgdHafkdvsehlqqiiafl 186
                  +++++g + +++tqe+y++  +h  e ++ ++ ++++per+lvll+++Devldyr+a+ ++++++ ++e +gdH+f + +++lq + +fl
  VIMSS202985  99 FDEFMGPQFNPYTQEHYQVLPEHKREVAEFNTPVIRNPERFLVLLQTGDEVLDYREALHKYHHCQLRIESGGDHSFVGYERYLQTVSQFL 188
                  **************************************************************************************9997 PP



Or compare VIMSS202985 to CDD or PaperBLAST