PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS3407186 to PF05728 (UPF0227)

VIMSS3407186 has 191 amino acids

Query:       UPF0227  [M=187]
Accession:   PF05728.12
Description: Uncharacterised protein family (UPF0227)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    7.4e-76  240.4   0.0    8.4e-76  240.2   0.0    1.0  1  VIMSS3407186  


Domain annotation for each sequence (and alignments):
>> VIMSS3407186  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  240.2   0.0   8.4e-76   8.4e-76       2     186 ..       4     188 ..       3     189 .. 0.99

  Alignments for each domain:
  == domain 1  score: 240.2 bits;  conditional E-value: 8.4e-76
       UPF0227   2 llYlHGFdSSPlshkaqllsqfiaedvlaielsvlklkedpqqalkeleklvaelgddnillvGssLGGyyatrlgerfglrqvllnPalkplenla 98 
                   llYlHGF+SSP+s+ka  l++++a+++++i+++v++l+ +p++a + le+lv e+g + +++vGssLGGyyat+l+++f+l +v++nPa++p+e l+
  VIMSS3407186   4 LLYLHGFNSSPRSAKATSLQRWLAQQHPEINMVVPQLPPYPSDATELLESLVLEHGGEPLGVVGSSLGGYYATWLSQCFMLPAVVVNPAVRPFELLT 100
                   89*********************************************************************************************** PP

       UPF0227  99 gklgeeavqstqetyvleeyhiielkalelsrlkrperilvllskqDevldyrravaefraaaeiveddgdHafkdvsehlqqiiafl 186
                   ++lg++++++t+++yvle++hi++lk+++++ l++p+ i++l++++Devldyr+ava++++++++ve +g+Haf ++++++ qi++fl
  VIMSS3407186 101 DFLGANENPYTGQQYVLESRHIYDLKVMQIEPLEAPDLIWLLQQTGDEVLDYRQAVAYYAPCRQTVETGGNHAFAGFEDYFTQIVDFL 188
                   **************************************************************************************97 PP



Or compare VIMSS3407186 to CDD or PaperBLAST