PaperBLAST – Find papers about a protein or its homologs

 

Align WP_080028002.1 to PF05728 (UPF0227)

WP_080028002.1 has 193 amino acids

Query:       UPF0227  [M=187]
Accession:   PF05728.12
Description: Uncharacterised protein family (UPF0227)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.7e-44  138.1   0.1      2e-44  137.9   0.1    1.0  1  WP_080028002.1  


Domain annotation for each sequence (and alignments):
>> WP_080028002.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  137.9   0.1     2e-44     2e-44       2     186 ..       3     188 ..       2     189 .. 0.92

  Alignments for each domain:
  == domain 1  score: 137.9 bits;  conditional E-value: 2e-44
         UPF0227   2 llYlHGFdSSPlshkaqllsqfiaedvlaielsvlklkedpqqalkeleklvaelgddnillvGssLGGyyatrlgerfglrqvllnPalkplen 96 
                     ++YlHGF+SS ls k   l q++ e +++  +  ++l+ +p q+++++ +l++ l   n++lvGssLGG++at+  +++ + +vl+nPa++p + 
  WP_080028002.1   3 IIYLHGFNSSSLSIKGLSLRQYCSELGIN--VHLPNLNRSPDQVVEQVSELIESLD--NVALVGSSLGGFFATYFVAKYNIPAVLINPAMQPWKL 93 
                     9***********************98865..56789999*************9987..89*********************************** PP

         UPF0227  97 lagklgeeavqst.qetyvleeyhiielkalelsrlkrperilvllskqDevldyrravaefraaa..eiveddg..dHafkdvsehlqqiiafl 186
                     +++    e++++  ++++ +++ ++ +l+ lel++ ++ ++ilvll+++De+ldyr+a+ +++aa    ++  d   +Ha++d++e+l  +i+f+
  WP_080028002.1  94 FDELFQVESMPYVvNDQWSIDHVQLRQLQQLELKQPENADKILVLLQQGDEILDYRQAQRYYSAATpsSLILTDAhgNHAMEDFEEKLPLVIEFF 188
                     ******99999853789*********************************************988533455555447****************98 PP



Or compare WP_080028002.1 to CDD or PaperBLAST