PaperBLAST – Find papers about a protein or its homologs

 

Align reanno::PV4:5208032 to PF05728 (UPF0227)

reanno::PV4:5208032 has 192 amino acids

Query:       UPF0227  [M=187]
Accession:   PF05728.12
Description: Uncharacterised protein family (UPF0227)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    6.8e-58  181.8   0.0    7.6e-58  181.7   0.0    1.0  1  reanno::PV4:5208032  


Domain annotation for each sequence (and alignments):
>> reanno::PV4:5208032  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  181.7   0.0   7.6e-58   7.6e-58       1     186 [.       1     188 [.       1     189 [. 0.97

  Alignments for each domain:
  == domain 1  score: 181.7 bits;  conditional E-value: 7.6e-58
              UPF0227   1 kllYlHGFdSSPlshkaqllsqfiaedvlaielsvlklkedpqqalkeleklvaelgddn..illvGssLGGyyatrlgerfglrqvlln 88 
                          +llY+HGF+SSP+s k ++  q+ia++ ++i+++ ++l+  p+ a++ l  lv++  +    +  +GssLGGy+a +l+er+g r+vl+n
  reanno::PV4:5208032   1 MLLYIHGFNSSPHSDKGVVTAQYIAKHFPDINFVQPQLPATPKAAMALLTDLVEQALEMGesLSFIGSSLGGYFASYLAERYGGRAVLVN 90 
                          79****************************************************987544459*************************** PP

              UPF0227  89 PalkplenlagklgeeavqstqetyvleeyhiielkalelsrlkrperilvllskqDevldyrravaefraaaeiveddgdHafkdvseh 178
                          Pa+kp+e ++++lg + +++t+e+y++  +h  e +  ++ ++ +p+r+lvll+ +Devldyr+av++++ ++ ++e++gdH+f + +++
  reanno::PV4:5208032  91 PAVKPFELFDEFLGPQYNPYTEEDYQILPEHKLEVAKYDTPAISHPDRFLVLLQSGDEVLDYRQAVNKYQCCQMLIEAGGDHSFVGYQQQ 180
                          ****************************************************************************************** PP

              UPF0227 179 lqqiiafl 186
                          +  i +fl
  reanno::PV4:5208032 181 MPGICDFL 188
                          **999996 PP



Or compare reanno::PV4:5208032 to CDD or PaperBLAST