PaperBLAST – Find papers about a protein or its homologs

 

Align reanno::SB2B:6938946 to PF05728 (UPF0227)

reanno::SB2B:6938946 has 191 amino acids

Query:       UPF0227  [M=187]
Accession:   PF05728.12
Description: Uncharacterised protein family (UPF0227)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence             Description
    ------- ------ -----    ------- ------ -----   ---- --  --------             -----------
    1.5e-54  171.0   0.0    1.6e-54  170.8   0.0    1.0  1  reanno::SB2B:6938946  


Domain annotation for each sequence (and alignments):
>> reanno::SB2B:6938946  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  170.8   0.0   1.6e-54   1.6e-54       1     186 [.       1     188 [.       1     189 [. 0.98

  Alignments for each domain:
  == domain 1  score: 170.8 bits;  conditional E-value: 1.6e-54
               UPF0227   1 kllYlHGFdSSPlshkaqllsqfiaedvlaielsvlklkedpqqalkeleklvaelgddn..illvGssLGGyyatrlgerfglrqvll 87 
                           +llY+HGF+SSP+s k  +  +fia+ ++ + l+ ++l+ d + a++ l ++ +e +++   +  +GssLGG++at+l+e +g +++l+
  reanno::SB2B:6938946   1 MLLYIHGFNSSPQSDKGLQSANFIAANHPGVRLVQPQLPTDIERAVALLCEITEEAKARGepLRFIGSSLGGFFATYLAETYGGKAALI 89 
                           79****************************************************9999888799************************* PP

               UPF0227  88 nPalkplenlagklgeeavqstqetyvleeyhiielkalelsrlkrperilvllskqDevldyrravaefraaaeiveddgdHafkdvs 176
                           nPa+ p+  ++ +lg +++++t+e+y +   h  +lk  +++++ +p+r++vll+++Devldyr a+ ++  ++ ++e +gdH+f +++
  reanno::SB2B:6938946  90 NPAVSPYDLFEAFLGPQHNPYTGEDYLVLPSHREALKRYDVAAIANPDRFFVLLQTGDEVLDYRLALGKYYCCRMLIEPGGDHSFVGFE 178
                           ***************************************************************************************** PP

               UPF0227 177 ehlqqiiafl 186
                           ++l  i afl
  reanno::SB2B:6938946 179 RQLPDIAAFL 188
                           ********97 PP



Or compare reanno::SB2B:6938946 to CDD or PaperBLAST