PaperBLAST – Find papers about a protein or its homologs

 

Align reanno::psRCH2:GFF477 to PF05728 (UPF0227)

reanno::psRCH2:GFF477 has 201 amino acids

Query:       UPF0227  [M=187]
Accession:   PF05728.12
Description: Uncharacterised protein family (UPF0227)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence              Description
    ------- ------ -----    ------- ------ -----   ---- --  --------              -----------
    3.2e-65  205.7   0.0    3.6e-65  205.5   0.0    1.0  1  reanno::psRCH2:GFF477  


Domain annotation for each sequence (and alignments):
>> reanno::psRCH2:GFF477  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  205.5   0.0   3.6e-65   3.6e-65       1     186 [.       7     190 ..       7     191 .. 0.99

  Alignments for each domain:
  == domain 1  score: 205.5 bits;  conditional E-value: 3.6e-65
                UPF0227   1 kllYlHGFdSSPlshkaqllsqfiaedvlaielsvlklkedpqqalkeleklvaelgddnillvGssLGGyyatrlgerfglrqvlln 88 
                            ++lY+HG +SSPls ka++ls+++++ +la  l+v++l+++p+qa+++le+ ++elg  ++llvGssLGGyyat+l+er+gl++ l+n
  reanno::psRCH2:GFF477   7 SILYIHGLNSSPLSQKASQLSAALEKLGLAERLRVPALHHHPRQAIAQLEACISELG--RPLLVGSSLGGYYATHLAERHGLKALLIN 92 
                            59*******************************************************..68*************************** PP

                UPF0227  89 PalkplenlagklgeeavqstqetyvleeyhiielkalelsrlkrperilvllskqDevldyrravaefraaaeiveddgdHafkdvs 176
                            Pa++p++ ++g+lg +++ +++e ++l+e+h+++l++le++  +  er++v+l+++De+ldyr a++ +r +a +++++gdH+f+++s
  reanno::psRCH2:GFF477  93 PAVTPHRRFDGYLGPQTNLYSGEVWELTEDHVAALAELETAPPQDAERYQVWLQTADETLDYRDAAQFYRGCALRIQAGGDHGFQGFS 180
                            **************************************************************************************** PP

                UPF0227 177 ehlqqiiafl 186
                            e l +++af+
  reanno::psRCH2:GFF477 181 ERLPALLAFA 190
                            ********97 PP



Or compare reanno::psRCH2:GFF477 to CDD or PaperBLAST