PaperBLAST – Find papers about a protein or its homologs

 

Align reanno::pseudo6_N2E2:Pf6N2E2_3637 to PF05728 (UPF0227)

reanno::pseudo6_N2E2:Pf6N2E2_3637 has 202 amino acids

Query:       UPF0227  [M=187]
Accession:   PF05728.12
Description: Uncharacterised protein family (UPF0227)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                          -----------
    2.9e-66  209.1   0.1    3.3e-66  208.9   0.1    1.0  1  reanno::pseudo6_N2E2:Pf6N2E2_3637  


Domain annotation for each sequence (and alignments):
>> reanno::pseudo6_N2E2:Pf6N2E2_3637  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  208.9   0.1   3.3e-66   3.3e-66       1     186 [.       4     187 ..       4     188 .. 0.99

  Alignments for each domain:
  == domain 1  score: 208.9 bits;  conditional E-value: 3.3e-66
                            UPF0227   1 kllYlHGFdSSPlshkaqllsqfiaedvlaielsvlklkedpqqalkeleklvaelgddnillvGssLGGyyatrl 76 
                                        ++lY+HGF+S P s ka++l +++a+ +l  +l+v++l+++p+qa+ +le+++a+lg  ++llvGssLGGyyat+l
  reanno::pseudo6_N2E2:Pf6N2E2_3637   4 SILYIHGFNSAPASTKASQLINVMAQLGLSDHLQVPALHHHPRQAIGQLEQAIAQLG--RPLLVGSSLGGYYATHL 77 
                                        59*******************************************************..68*************** PP

                            UPF0227  77 gerfglrqvllnPalkplenlagklgeeavqstqetyvleeyhiielkalelsrlkrperilvllskqDevldyrr 152
                                        +er+gl++ l+nPa+ p++ ++g+lg +++ +t+et++l+++h+ +l++l++ + + p+r++v+l+++De+ldyr+
  reanno::pseudo6_N2E2:Pf6N2E2_3637  78 AERHGLKALLINPAVSPHRMFDGYLGTQKNLYTDETWELTHDHVTALAELDVPAPRDPQRFQVWLQTGDETLDYRH 153
                                        **************************************************************************** PP

                            UPF0227 153 avaefraaaeiveddgdHafkdvsehlqqiiafl 186
                                        a++++ra+a +++++gdH+f++++++l ++++f+
  reanno::pseudo6_N2E2:Pf6N2E2_3637 154 AQQYYRACALRIQAGGDHSFQGFAQQLPALLSFA 187
                                        *******************************997 PP



Or compare reanno::pseudo6_N2E2:Pf6N2E2_3637 to CDD or PaperBLAST