PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001112362.1 to PF05768 (DUF836)

NP_001112362.1 has 106 amino acids

Query:       DUF836  [M=82]
Accession:   PF05768.14
Description: Glutaredoxin-like domain (DUF836)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.2e-09   24.0   0.1    2.8e-09   23.6   0.1    1.2  1  NP_001112362.1  


Domain annotation for each sequence (and alignments):
>> NP_001112362.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   23.6   0.1   2.8e-09   2.8e-09       1      41 [.      14      53 ..      14      80 .. 0.81

  Alignments for each domain:
  == domain 1  score: 23.6 bits;  conditional E-value: 2.8e-09
                    -EEEEE-TT-HHHHHHHHHHHHHCCCTTEEEEEEETTT-CC CS
          DUF836  1 kltLyskpgChlCeqakekLkelkleegleleviDIakdee 41
                    k++ + kp C+ C +a+e+L++l +++g  le +DI+  ++
  NP_001112362.1 14 KVVVFIKPTCPYCRRAQEILSQLPIKQG-LLEFVDITATNH 53
                    5899***********************9.899****94333 PP



Or compare NP_001112362.1 to CDD or PaperBLAST