PaperBLAST – Find papers about a protein or its homologs

 

Align NP_490812.1 to PF05768 (Glrx-like)

NP_490812.1 has 105 amino acids

Query:       Glrx-like  [M=81]
Accession:   PF05768.18
Description: Glutaredoxin-like domain (DUF836)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
      2e-09   24.1   0.0    2.2e-09   23.9   0.0    1.3  1  NP_490812.1  


Domain annotation for each sequence (and alignments):
>> NP_490812.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   23.9   0.0   2.2e-09   2.2e-09       1      44 [.      14      56 ..      14     100 .. 0.78

  Alignments for each domain:
  == domain 1  score: 23.9 bits;  conditional E-value: 2.2e-09
    Glrx-like  1 kliLyskpgCglCeeaeevLeelkledglelevidIdedeelee 44
                 k++ +sk +C+ C++a+++Le ++ + +  l+ i Ide+++ +e
  NP_490812.1 14 KVVVFSKSYCPYCHKARAALESVNVKPD-ALQWIEIDERKDCNE 56
                 6999*******************99998.888888887776443 PP



Or compare NP_490812.1 to CDD or PaperBLAST