PaperBLAST – Find papers about a protein or its homologs

 

Align NP_490812.1 to PF05768 (DUF836)

NP_490812.1 has 105 amino acids

Query:       DUF836  [M=82]
Accession:   PF05768.14
Description: Glutaredoxin-like domain (DUF836)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.7e-09   23.7   0.0    2.9e-09   23.6   0.0    1.2  1  NP_490812.1  


Domain annotation for each sequence (and alignments):
>> NP_490812.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   23.6   0.0   2.9e-09   2.9e-09       1      43 [.      14      55 ..      14      99 .. 0.84

  Alignments for each domain:
  == domain 1  score: 23.6 bits;  conditional E-value: 2.9e-09
                 -EEEEE-TT-HHHHHHHHHHHHHCCCTTEEEEEEETTT-CCCH CS
       DUF836  1 kltLyskpgChlCeqakekLkelkleegleleviDIakdeele 43
                 k++ +sk +C+ C++a ++L+ ++++ +  l+ i I+++++ +
  NP_490812.1 14 KVVVFSKSYCPYCHKARAALESVNVKPD-ALQWIEIDERKDCN 55
                 6899***********************9.99999999877643 PP



Or compare NP_490812.1 to CDD or PaperBLAST