PaperBLAST – Find papers about a protein or its homologs

 

Align WP_013955085.1 to PF05768 (DUF836)

WP_013955085.1 has 104 amino acids

Query:       DUF836  [M=82]
Accession:   PF05768.14
Description: Glutaredoxin-like domain (DUF836)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    3.4e-09   23.3   0.0    4.8e-09   22.9   0.0    1.3  1  WP_013955085.1  


Domain annotation for each sequence (and alignments):
>> WP_013955085.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   22.9   0.0   4.8e-09   4.8e-09       9      49 ..      30      70 ..      23     100 .. 0.85

  Alignments for each domain:
  == domain 1  score: 22.9 bits;  conditional E-value: 4.8e-09
                    T-HHHHHHHHHHHHHCCCTTEEEEEEETTT-CCCHCCCCTT CS
          DUF836  9 gChlCeqakekLkelkleegleleviDIakdeeleakYgle 49
                     C+ C   ke L+el++++++ + +++I+++ +l ++++++
  WP_013955085.1 30 WCGPCRMFKESLSELAEKDNVLVYRVNIDENSDLASQFQVR 70
                    5**************************************86 PP



Or compare WP_013955085.1 to CDD or PaperBLAST