PaperBLAST – Find papers about a protein or its homologs

 

Align BRENDA::A1C3J6 to PF05787 (DUF839)

BRENDA::A1C3J6 has 647 amino acids

Query:       DUF839  [M=524]
Accession:   PF05787.13
Description: Bacterial protein of unknown function (DUF839)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
   2.8e-183  596.8   5.8   3.3e-183  596.6   5.8    1.0  1  BRENDA::A1C3J6  


Domain annotation for each sequence (and alignments):
>> BRENDA::A1C3J6  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  596.6   5.8  3.3e-183  3.3e-183       2     524 .]      71     603 ..      70     603 .. 0.94

  Alignments for each domain:
  == domain 1  score: 596.6 bits;  conditional E-value: 3.3e-183
          DUF839   2 gfgplaaklddlvavpegyeakvlvrwGdkl..fagapefd....qsaeaqekqvgynhDgmaffplsrsad.eglLvvNhEytseeilfekekp 89 
                      f+++  +++d v vp+gy+ak + +wGd++   ++ p+f     +sae+q+ q g+nhDgma+fp  ++ + +glLv+NhEy+++ +lf     
  BRENDA::A1C3J6  71 TFTSIPFSTEDRVIVPKGYSAKAFYAWGDPVglENNNPQFKvdasNSAEEQAAQAGMNHDGMAYFPFAEHGNeHGLLVMNHEYIDNGLLF-PDGD 164
                     688899999*********************7336888999899*9*********************985555388**************9.7777 PP

          DUF839  90 spvtaelvekelaalGvtvveisrkagkwqvvrdsklnrritantemrlsGPaagsellktsadaegvkilGTanNCagGtTpWGtyLtcEEnfn 184
                     +  + ++v+k+++a+G +v+ei++ +++w+vvr sk+ rrit +t+mrl+GPa  +el+kt ad+ g  +lGT++NCa+G TpW tyLtcEEn++
  BRENDA::A1C3J6 165 KTWSLDKVKKSQNAMGISVIEIKKVNQQWEVVRPSKYARRITPHTPMRLTGPAKHNELMKTVADPLGEFVLGTMQNCANGETPWRTYLTCEENWS 259
                     899*******************999********************************************************************** PP

          DUF839 185 gyfgge.eavkadqkryGit.gttgy.........erFdva...nepkkfGyvvEvdpvdprstpvkrtalGrfkHEaaavvveddkrvvvYlgd 265
                     + f  e  + ++ +kryGi  + ++          erF+ +   nep++fG+vvE+dp dp+stpvk+talGrfkHE+a +v++++++ vvY+gd
  BRENDA::A1C3J6 260 DIFVREsGDFTKLDKRYGIMkK-EKEdkyrwnefdERFNTDkhpNEPHRFGWVVEIDPFDPNSTPVKHTALGRFKHEGAMLVLSKEGHAVVYMGD 353
                     *999885669999******853.332345**9999999999****************************************************** PP

          DUF839 266 DerkeylYkFvsndrvgtgnskansaLldeGtLyvakfnedgtveWvplvegqggltaengfadqaevlvktrlaadkvGatkmdrpEdievnPt 360
                     D+r+ey+YkFvs++++++ +++an+ Ll eGtLyva+fned t+eW plv+ q+gltaengf +q++v +k+r aad vG+tkmdrpE+i+v P 
  BRENDA::A1C3J6 354 DQRFEYIYKFVSKGKYNPADRAANMYLLSEGTLYVAHFNEDNTGEWRPLVHNQNGLTAENGFLNQGDVTIKARMAADVVGGTKMDRPEWIAVDPY 448
                     **********************************************************************************************7 PP

          DUF839 361 tg.evyvvltnnkkrde...skidsanpraknkyGqivrlieesrdvaatkftwdlfllaGdpedakaasaessegndlespDnlafdpaGrlwi 451
                     +  +vy++ltnn++r++     id+anpr kn+yG+i+r++e+++d+ +++f wd+f+l G+    k++ +++ +g+d+ spD+l fd++G lw+
  BRENDA::A1C3J6 449 QTgSVYCTLTNNSQRGTegkAGIDAANPRVKNSYGHIIRWQENDQDYLSETFSWDIFALGGN----KSKGENHVNGDDFGSPDGLRFDNHGILWV 539
                     666**********9998877889**************************************9....4456899********************** PP

          DUF839 452 atDgsgskdellgvtaeGkvynlarndGnn.vltsdaargevkrfltepegsEvtGvtfsPdgktlfvnvqhPg 524
                     +tD s+s+ +          ++  +  Gnn +l+  +++ge krflt+p+gsEvtG++f+Pd+kt+f+n+qhPg
  BRENDA::A1C3J6 540 QTDVSSSTLN----------KKAYEGMGNNqMLAVIPEQGEFKRFLTAPNGSEVTGIAFTPDNKTMFINIQHPG 603
                     ******9876..........33345679999******************************************9 PP



Or compare BRENDA::A1C3J6 to CDD or PaperBLAST