PaperBLAST – Find papers about a protein or its homologs

 

Align F5Y472 to PF05787 (DUF839)

F5Y472 has 643 amino acids

Query:       DUF839  [M=524]
Accession:   PF05787.13
Description: Bacterial protein of unknown function (DUF839)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
     8e-182  592.0   0.0   9.3e-182  591.8   0.0    1.0  1  F5Y472    


Domain annotation for each sequence (and alignments):
>> F5Y472  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  591.8   0.0  9.3e-182  9.3e-182       3     524 .]      62     599 ..      60     599 .. 0.96

  Alignments for each domain:
  == domain 1  score: 591.8 bits;  conditional E-value: 9.3e-182
  DUF839   3 fgplaaklddlvavpegyeakvlvrwGdkl..fagapefd....qsaeaqekqvgynhDgmaffplsrsadeglLvvNhEytseeilfekekpspvtaelvek 99 
             f+p+   + d + vp+gy a  l+ wG+++    + p +     ++a++q+ q+g++hDg+++fpl+  + +glLv+NhEy+++ +l+ +  ++  t e+v+k
  F5Y472  62 FEPVPIGAGDRLIVPKGYVASALAPWGEPVglPGNLPVWRpdagNTADEQAAQMGMHHDGLHYFPLD-GSRRGLLVMNHEYVDDGLLH-ADGLKTWTLEKVRK 162
             7888889999*******************832468888889999**********************6.7789**************97.999*********** PP

  DUF839 100 elaalGvtvveisrk.agkwqvvrdsklnrritantemrlsGPaagsellktsadaegvkilGTanNCagGtTpWGtyLtcEEnfngyfggeeavkadqkryG 201
             ++aa+G  v+e+++   g+w +vr s++ rritant+++l GPaag+ l++t+ad++g+++lGT+nNCa G TpWGtyL++EEnf +yf++  +++a+q+r G
  F5Y472 163 SQAAHGIAVIEVEQAaGGEWRMVRPSRFARRITANTPFNLGGPAAGHPLMRTAADPQGRTVLGTFNNCAAGITPWGTYLSGEENFRNYFAAGSSLDAHQRRWG 265
             ************999999************************************************************************9999********* PP

  DUF839 202 itgttgy......erFdva...nepkkfGyvvEvdpvdprstpvkrtalGrfkHEaaavvveddkrvvvYlgdDerkeylYkFvsndrvgtgns.....kans 290
             +t t  +       rFd++   nep++fG+vvEvdp dp stpvkrtalGr +HE+a v+v++d+r vvY+g+D r+ey+YkFvs+dr+++ ++     +an+
  F5Y472 266 LTATAFFrwaehdPRFDAVgnpNEPNRFGWVVEVDPMDPASTPVKRTALGRAAHEGAWVAVTRDGRAVVYSGEDARNEYIYKFVSRDRIRPAGNgltaaQANR 368
             *98777789*********************************************************************************9988899999*** PP

  DUF839 291 aLldeGtLyvakfnedgtveWvplvegqggltaengfadqaevlvktrlaadkvGatkmdrpEdievnPttgevyvvltnnkkrdeski...dsanpraknky 390
             +Lld+GtLyva+f++dg ++W+plv+gqg+lta ngfadq+e+++k r+a d +GatkmdrpE++++ P++g vy++ltnn+ r+++ +   d+anpra+n++
  F5Y472 369 ELLDHGTLYVARFDADGVGQWLPLVHGQGPLTAANGFADQGEIVIKSRQASDLLGATKMDRPEWLAIDPVNGTVYCTLTNNADRGKEGMpgpDAANPRANNAH 471
             **********************************************************************************9999777778*********** PP

  DUF839 391 Gqivrlieesr...dvaatkftwdlfllaGdpedakaasaessegndlespDnlafdpaGrlwiatDgsgskdellgvtaeGkvynlarndGnn.vltsdaar 489
             G+i+r++e  +   d++a++f+wd ++laGdp++ +a  +++++g+ +++pD+lafd++G lwi+tD ++ +        +G+   +    Gnn +l+ d a+
  F5Y472 472 GHIIRWREGGEdggDFDAARFRWDHLVLAGDPAQPRAGAKGNIRGDLFACPDGLAFDARGMLWIQTDAHATQM------YKGEFASI----GNNqMLACDVAT 564
             *******9877555899****************************************************9654......58887777....6666******** PP

  DUF839 490 gevkrfltepegsEvtGvtfsPdgktlfvnvqhPg 524
             gev+rflt+p++sEvtG+t++Pdg+t+f+n+qhPg
  F5Y472 565 GEVRRFLTGPTNSEVTGMTMTPDGRTMFINIQHPG 599
             **********************************9 PP



Or compare F5Y472 to CDD or PaperBLAST