PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS123764 to PF05787 (DUF839)

VIMSS123764 has 667 amino acids

Query:       DUF839  [M=524]
Accession:   PF05787.13
Description: Bacterial protein of unknown function (DUF839)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   1.1e-210  687.2   6.0   1.3e-210  687.0   6.0    1.0  1  VIMSS123764  


Domain annotation for each sequence (and alignments):
>> VIMSS123764  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  687.0   6.0  1.3e-210  1.3e-210       2     524 .]      84     628 ..      83     628 .. 0.98

  Alignments for each domain:
  == domain 1  score: 687.0 bits;  conditional E-value: 1.3e-210
       DUF839   2 gfgplaaklddlvavpegyeakvlvrwGdklfagapefd...qsaeaqekqvgynhDgmaffplsrsadeglLvvNhEytseeilf............ 84 
                  +f++++a  d++++v+egy+a++l+rwGdk+fa++pefd   q+a+aq++q+gyn+D+++f+pl+++ d+glLvvNhEyt++ei+f            
  VIMSS123764  84 DFKEIEAGVDETHHVAEGYDADILLRWGDKVFADSPEFDplkQTADAQSRQFGYNNDYVGFIPLEGNPDHGLLVVNHEYTNAEIMFpnfarvekvted 181
                  799*********************************************************************************************** PP

       DUF839  85 ....ekekpspvtaelvekelaalGvtvveisrkagkwqvvrdsklnrritantemrlsGPaagsellktsadaegvkilGTanNCagGtTpWGtyLt 178
                      +k+ + ++t+elv+ e+aa+G+tv+ei++ +gkwq v d+k+nrrita+tem+lsGPaag+e++kt +d++g+k++GT+nNCagG+T+WGty++
  VIMSS123764 182 gkeeDKVVLGEYTKELVDIEMAAHGGTVIEIRKVDGKWQPVLDGKYNRRITATTEMQLSGPAAGHERVKTPSDPTGRKVFGTINNCAGGVTAWGTYMM 279
                  *998889999*********************999**************************************************************** PP

       DUF839 179 cEEnfngyfgge.ea...vkadqkryGitgttgy......erFdva...nepkkfGyvvEvdpvdprstpvkrtalGrfkHEaaavvveddkrvvvYl 263
                  +EEnfngyfgge  +   + +++kr+G   + +y      +rFdv+   ne+++fG+vvEvdp +p+s p+krta+GrfkHE+++ +v++d+rvv+Y+
  VIMSS123764 280 AEENFNGYFGGElAEdhpEFKQMKRLGTP-GGQYewskfyDRFDVSkepNEANRFGWVVEVDPLNPTSVPKKRTAIGRFKHEGCESIVNRDGRVVLYS 376
                  ***********9755789999******76.3455569999******99************************************************** PP

       DUF839 264 gdDerkeylYkFvsndrvgtgnskansaLldeGtLyvakfnedgtveWvplvegqggltaengfadqaevlvktrlaadkvGatkmdrpEdievnPtt 361
                  gdDer +y+YkFv+++++++++++an++L+deGtLyvakf+edgtv+W+plv+g+g+ltaengfa+qa+vl++trlaad++GatkmdrpEd+++nP+t
  VIMSS123764 377 GDDERYDYVYKFVTKGTYNPDDRAANMDLFDEGTLYVAKFDEDGTVTWMPLVHGEGPLTAENGFASQADVLIDTRLAADALGATKMDRPEDVQPNPKT 474
                  ************************************************************************************************** PP

       DUF839 362 gevyvvltnnkkrdeskidsanpraknkyGqivrlieesrdvaatkftwdlfllaGdpedaka...asaessegndlespDnlafdpaGrlwiatDgs 456
                  g+vyv+ltnn+kr+e++id+anprakn++G+iv++ e+++d+a+tk +wd++l++Gdp++a++   +s+++++++++ +pDn+a+d++Grlw++tDg+
  VIMSS123764 475 GKVYVMLTNNTKRKEDEIDAANPRAKNAFGHIVEISETDGDFASTKSRWDVLLKCGDPSVAEVgasFSTATTRNGWFGMPDNCAIDAEGRLWVSTDGN 572
                  **************************************************************99999******************************* PP

       DUF839 457 gskdellgvtaeGkvynlarndGnn.vltsdaargevkrfltepegsEvtGvtfsPdgktlfvnvqhPg 524
                  ++kd+             +r+dG++ v+t+++ rg++k+f++ p+g+E++G+ f+P+++t+f++vqhPg
  VIMSS123764 573 NEKDT-------------GRTDGVWaVETEGEGRGTSKLFFRVPVGAEMCGPSFNPTSDTFFLAVQHPG 628
                  *9987.............8999*99*******************************************9 PP



Or compare VIMSS123764 to CDD or PaperBLAST