PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS201529 to PF05787 (DUF839)

VIMSS201529 has 685 amino acids

Query:       DUF839  [M=524]
Accession:   PF05787.13
Description: Bacterial protein of unknown function (DUF839)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
     1e-157  512.5   0.9   1.2e-157  512.2   0.9    1.0  1  VIMSS201529  


Domain annotation for each sequence (and alignments):
>> VIMSS201529  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  512.2   0.9  1.2e-157  1.2e-157       2     524 .]      80     648 ..      79     648 .. 0.91

  Alignments for each domain:
  == domain 1  score: 512.2 bits;  conditional E-value: 1.2e-157
       DUF839   2 gfgplaaklddlvavpegyeakvlvrwGdklfagapefd....qsaeaqekqvgynhDgmaffplsrsadeglLvvNhEytseeilf......ekekp 89 
                  +f++++  + ++v+vpegy+a+vl+ wG++l a+a  +     ++a++q++ vg++hDgm+ffpl++  d glL++NhEy++e  l+      +++++
  VIMSS201529  80 NFTSVKGARLNAVVVPEGYSAQVLAPWGTPLNAKAAPWKadgsNTADDQANSVGMHHDGMHFFPLNQAGDDGLLCINHEYIDEIALHpngptvDATTG 177
                  577777888899***********************999999**************************************************9999999 PP

       DUF839  90 spvtaelvekelaalGvtvveisrkagkwqvvrdsklnrritantemrlsGPaagsellktsadaegvkilGTanNCagGtTpWGtyLtcEEnfngyf 187
                   ++  ++v+ke++a+Gv+vv+i+ ++++w+vv + k nrr+t +t m ++GP a s ll+t+ +++g ++ GT+nNC +G+TpWGtyLtcEEn+ +yf
  VIMSS201529 178 LRTIVDEVRKEINAHGVSVVRIKLTNNQWEVVYNDKHNRRFTGATVMDIAGPLAYSPLLETRYSPDGSQARGTLNNCGNGYTPWGTYLTCEENWPEYF 275
                  9999******************999************************************************************************* PP

       DUF839 188 ggeeavkadqkryGit.gttgy................erFdva...........nepkkfGyvvEvdpvdprstpvkrtalGrfkHEaaav.vvedd 256
                   ++ ++++dq r+Gi+  +++y                +rFdv+           ne++ +Gy+vE+dp++p+s++ krtalGrf+HE++++  ++++
  VIMSS201529 276 VNRSTLTRDQIRIGISkTSSRYgwddlagqdeerldefSRFDVTpkgvsarddyrNEANGHGYIVEIDPYNPTSRAIKRTALGRFRHEGCTFgKLSEG 373
                  **999***********777788****************9****999*********************************************9446777 PP

       DUF839 257 krvvvYlgdDerkeylYkFvsndrvgtgnskansaLl......deGtLyvakfnedgtveWvplvegqgglta....engfadqaevlvktrlaadkv 344
                  + vv+Y+g D r+eylYkFvs+ + ++++ +++++L+      +eGtLy+akfne+g + W+pl+  ++  t+     n fa+ a+++++t  aad +
  VIMSS201529 374 QPVVFYSGHDARFEYLYKFVSAAPWNPQDANSSNRLEigdkymNEGTLYAAKFNENGVGAWLPLTLDSQ-TTDgktlGNSFASLADIILNTAGAADLL 470
                  77**************************9977777743333339********************87533.3334656888****************** PP

       DUF839 345 GatkmdrpEdievnPttgevyvvltnnkkrdeskidsanpraknkyGqivrlieesrdvaatkftwdlfllaGdpedaka.asaessegndlespDnl 441
                  Gat+mdrpE+++v P tg+vy++ltnn+kr  ++++ anpr kn++G+i+r++e+++   +t+ftwd+f+  +++  + + +  + ++ n+++spD+l
  VIMSS201529 471 GATPMDRPEWCAVDPFTGSVYLTLTNNSKR--TEANPANPRLKNNFGHIIRWDEADK---ETEFTWDIFVFGSPSDGNAEtNLSGLTDLNQFASPDGL 563
                  ****************************88..99*********************99...9*********9987654433599*************** PP

       DUF839 442 afdpaGrlwiatDgsgskde..llgvtaeGkvynlarndGnn..vltsdaargevkrfltepegsEvtGvtfsPdgktlfvnvqhPg 524
                  afd++G lw++tD  +++    + ++  +   ++l      n    +  +++ e+krf+ +p+++EvtG ++sPd kt+f n+qhPg
  VIMSS201529 564 AFDKRGILWVQTDNGAEEVAeeTNDQMLAIVPSTLLDSA--NkqTSVTAKNQMELKRFFVGPNDCEVTGFAISPDYKTVFANIQHPG 648
                  *************99865333322222233334443332..335788889999*********************************9 PP



Or compare VIMSS201529 to CDD or PaperBLAST