PaperBLAST – Find papers about a protein or its homologs

 

Align WP_011047593.1 to PF05787 (DUF839)

WP_011047593.1 has 627 amino acids

Query:       DUF839  [M=524]
Accession:   PF05787.13
Description: Bacterial protein of unknown function (DUF839)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
   4.9e-180  586.1   8.3   5.7e-180  585.9   8.3    1.0  1  WP_011047593.1  


Domain annotation for each sequence (and alignments):
>> WP_011047593.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  585.9   8.3  5.7e-180  5.7e-180       2     524 .]      68     596 ..      67     596 .. 0.96

  Alignments for each domain:
  == domain 1  score: 585.9 bits;  conditional E-value: 5.7e-180
          DUF839   2 gfgplaaklddlvavpegyeakvlvrwGdklfagapefd....qsaeaqekqvgynhDgmaffplsrsadeglLvvNhEytseeilf.ekekpsp 91 
                      f+++aa++ d ++vp+g++a+vlvrw d+l ++  +fd     +a+ q++ +g n+Dgm++f+    + ++lLvvN+Eyt+ ei++ +++++++
  WP_011047593.1  68 AFEAVAASTADEIVVPKGFKADVLVRWADPLWSDGVAFDqvtrGTAASQARAFGDNTDGMEVFHH---EGRTLLVVNNEYTNREIIWgNRAEGKA 159
                     6999***********************************999879999****************9...89***************9967889999 PP

          DUF839  92 vtaelvekelaalGvtvveisrkagkwqvvrdsklnrritantemrlsGPaagsellktsadaegvkilGTanNCagGtTpWGtyLtcEEnfngy 186
                      t ++vek l a+Gvtvve+++   +wqvv+ds +nrrit  tem+l+GPaag++l+kt+ad++g+ ++GT nNC  GtTpWGtyL cEEnfngy
  WP_011047593.1 160 ETDDDVEKGLLAHGVTVVELAHDGAHWQVVTDSPYNRRITPRTEMALTGPAAGHDLMKTAADPTGTVTFGTWNNCGSGTTPWGTYLACEENFNGY 254
                     *********************************************************************************************** PP

          DUF839 187 fgge.ea..vkadqkryGit.gttgy......erFdva...nepkkfGyvvEvdpvdprstpvkrtalGrfkHEaaavvveddkrvvvYlgdDer 268
                     f++  ea  v+a+ +ryG++ +  gy      +rFdva   nep++ GyvvE+dp dp+stp+krtalGrfkHE+a+ vv++d+r+v+Y+gdDer
  WP_011047593.1 255 FSAAdEAheVSAELNRYGVSaKDWGYgwarvdDRFDVAknpNEPNRAGYVVEIDPRDPNSTPKKRTALGRFKHENAECVVNRDGRLVIYMGDDER 349
                     *99955599***********999999********************************************************************* PP

          DUF839 269 keylYkFvsndrvgtgnskansaLldeGtLyvakfnedgtveWvplvegqggltaengfadqaevlvktrlaadkvGatkmdrpEdievnPttge 363
                     +e+lY++vsn+ + +g   ++ +L+++GtLy+akf+++g++ W+ l       t+e++ ++qae++++tr aa+k+Gat+mdrpE++  nP++ e
  WP_011047593.1 350 GEFLYRYVSNGVYAAG--VDTDELMENGTLYAAKFDASGKGIWLAL-------TPEATGMSQAEICIHTRIAASKLGATTMDRPEWVTANPNADE 435
                     **************88..6999*********************999.......789*************************************** PP

          DUF839 364 vyvvltnnkkrde........skidsanpraknkyGqivrlieesrdvaatkftwdlfllaGdpedaka...asaessegndlespDnlafdpaG 447
                     vy++ltnnk+r+         ++++  npr+kn+yGqivr+++e +d++a+ f wdlf+laG+p+++++    s++ ++gn+++spD+lafd++G
  WP_011047593.1 436 VYCALTNNKNRGVkpnrggddTPAEGPNPREKNNYGQIVRWRPEGGDHSAEGFDWDLFVLAGNPTVHSDanaGSENVNAGNMFNSPDGLAFDSNG 530
                     *********998889999988889*****************************************99987778889999**************** PP

          DUF839 448 rlwiatDgsgskdellgvtaeGkvynlarndGnn.vltsdaargevkrfltepegsEvtGvtfsPdgktlfvnvqhPg 524
                      lwi+tDg+ s++             +a  +Gnn +l+ d+ +ge++rfl +p+++E+tG ++s+d +t+fv+vqhPg
  WP_011047593.1 531 LLWIQTDGKYSNEG-----------DFA-GQGNNqMLAGDPVTGEIRRFLVGPREAEITGLCWSGDRRTMFVGVQHPG 596
                     **********9875...........676.779999******************************************9 PP



Or compare WP_011047593.1 to CDD or PaperBLAST