PaperBLAST – Find papers about a protein or its homologs

 

Align WP_041476178.1 to PF05787 (DUF839)

WP_041476178.1 has 631 amino acids

Query:       DUF839  [M=524]
Accession:   PF05787.13
Description: Bacterial protein of unknown function (DUF839)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
   1.8e-195  637.0   0.8   2.1e-195  636.8   0.8    1.0  1  WP_041476178.1  


Domain annotation for each sequence (and alignments):
>> WP_041476178.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  636.8   0.8  2.1e-195  2.1e-195       2     524 .]      59     600 ..      58     600 .. 0.97

  Alignments for each domain:
  == domain 1  score: 636.8 bits;  conditional E-value: 2.1e-195
          DUF839   2 gfgplaaklddlvavpegyeakvlvrwGdklfagapefd....qsaeaqekqvgynhDgmaffplsrsadeglLvvNhEytseeilfekekpspv 92 
                     gf+++aa + d++++p+gy+  vl++wG++l ++ap+fd     +a+aqe q+g n+Dgm++fp  + +++ l+++N+Eyt+ ++lf  + ++p 
  WP_041476178.1  59 GFNSIAAATADTITLPPGYKSSVLISWGQPLQKNAPAFDpsgnGTARAQEVQFGDNNDGMSLFPFPGDNNRALMAINNEYTNYQYLF-PHGGQPQ 152
                     799**************************************9989*****************************************9.999**** PP

          DUF839  93 taelvekelaalGvtvveisrkagkwqvvrdsklnrritantemrlsGPaagsellktsadaegvkilGTanNCagGtTpWGtyLtcEEnfngyf 187
                     +ae+v+k++a  Gv+v+ei+r++g+wq+v++s++nrri+ nt++rl GPaag++llktsad++g k+lGT++NCa+G+TpWGtyLtcEEnf++ f
  WP_041476178.1 153 SAEDVRKAQASEGVSVIEIQRRRGQWQFVQESRYNRRIHGNTPIRLRGPAAGHDLLKTSADKSGKKVLGTFQNCANGMTPWGTYLTCEENFTDCF 247
                     *********************************************************************************************** PP

          DUF839 188 ggeea...vkadqkryGit.gttgy......erFdva...nepkkfGyvvEvdpvdprstpvkrtalGrfkHEaaavvveddkrvvvYlgdDerk 269
                     g++++    +a qkryG t  +++        rFd+a   ne +++G+vvE+dp dp+stpvkrtalGrfkHE+aa++ ++d+r vvY+gdDer+
  WP_041476178.1 248 GSSKSdlqFDAAQKRYGATvASSEInwhlhdPRFDLAknpNELNRHGWVVEIDPFDPQSTPVKRTALGRFKHENAALAQTNDGRAVVYMGDDERG 342
                     999556889999******987777799**********99******************************************************** PP

          DUF839 270 eylYkFvsndrvgtgnskansaLldeGtLyvakfned........gtveWvplvegqggltaengfadqaevlvktrlaadkvGatkmdrpEdie 356
                     e++YkFvs++r++++n kans+Lld+GtLyva+f++         g+++W++l++g++gl+a +gfadqaevl+++rlaa++vGat+mdrpE+i 
  WP_041476178.1 343 EFIYKFVSRERINHRNAKANSNLLDHGTLYVARFDAGdgnpdhpkGQGQWIELTHGKNGLDASSGFADQAEVLIHARLAASAVGATRMDRPEWIV 437
                     ***********************************9899******************************************************** PP

          DUF839 357 vnPttgevyvvltnnkkrde..skidsanpraknkyGqivrlieesrdvaatkftwdlfllaGdpedaka....asaessegndlespDnlafdp 445
                     v+P+ g+vy++ltnn+kr++  ++++  nprakn yGqi+r+  +++d+a+++f+wdlf++aG+p+++       s +++ +n+++spD+l fd+
  WP_041476178.1 438 VSPKDGQVYCTLTNNSKRGDagQPVEGPNPRAKNVYGQILRWKTDRDDHASKTFAWDLFVVAGNPTVHAGtpkaGSSNINPQNMFNSPDGLGFDK 532
                     ****************9998899********************************************98888888999999************** PP

          DUF839 446 aGrlwiatDgsgskdellgvtaeGkvynlarndGnn.vltsdaargevkrfltepegsEvtGvtfsPdgktlfvnvqhPg 524
                      Grlwi+tDg++s++        G    +a   Gnn +l++d++ ge++rf+ +p+g+EvtG+ fsPd k++fv++qhP+
  WP_041476178.1 533 GGRLWIQTDGDSSNA--------G---DFA-GMGNNqMLCADPNSGEIRRFMVGPVGCEVTGISFSPDYKAMFVGIQHPS 600
                     ************865........4...455.457888******************************************5 PP



Or compare WP_041476178.1 to CDD or PaperBLAST