PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::B0VHH0 to PF05853 (BKACE)

SwissProt::B0VHH0 has 276 amino acids

Query:       BKACE  [M=274]
Accession:   PF05853.12
Description: beta-keto acid cleavage enzyme
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
     6e-104  333.2   0.2   6.7e-104  333.1   0.2    1.0  1  SwissProt::B0VHH0  


Domain annotation for each sequence (and alignments):
>> SwissProt::B0VHH0  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  333.1   0.2  6.7e-104  6.7e-104       1     274 []       3     274 ..       3     274 .. 0.98

  Alignments for each domain:
  == domain 1  score: 333.1 bits;  conditional E-value: 6.7e-104
                        SB-EEEE-S-SSS-CCC-TTS--SHHHHHHHHHHHHHHTESEEEE-EE-TTTS-EE--HHHHHHHHHHHHHHHTTSEEEE-SSTTTTG-HHH CS
              BKACE   1 kviitvavtGavttkednpavPvtpeeiaeeaveaaeaGAaivHlHaRdpedgrpsldpelyrevlarirekepdviinlttggastmsaee 92 
                        ++i+t+a+tGa tt++d+p++P+tpee+a+ea +++eaGA ++HlH+R+ +dgrps+++++++e++++ire  p++ii+++tgga+  s+++
  SwissProt::B0VHH0   3 PLILTAAITGAETTRADQPNLPITPEEQAKEAKACFEAGARVIHLHIRE-DDGRPSQRLDRFQEAISAIREVVPEIIIQISTGGAVGESFDK 93 
                        69***********************************************.99**********************************9999** PP

                        HHTHHHHH--SEEEEE-S-EEEB-SGCEE---HHHHHHHHHHHHHTT-EEEEEESSHHHHHHHHHHHHTTSS-.SSEEEEEEE--CTS--S- CS
              BKACE  93 rlavlealkpemasldlgslnfglkdlvfentpedieellrrmaeagvkpeievfdvghlrnvkrlieeGllk.gpllvqfvlgvpggapat 183
                        rla+l++ kpema+l++g+lnf  +d +f n+p+di +l++++++++v+pe+ev++ g+++ v+rli++G+++ +pl++qfvlgvpgg+  +
  SwissProt::B0VHH0  94 RLAPLAL-KPEMATLNAGTLNF--GDDIFINHPADIIRLAEAFKQYNVVPEVEVYESGMVDAVARLIKKGIITqNPLHIQFVLGVPGGMSGK 182
                        *****99.**************..8***********************************************989***************** PP

                        HHHHH.HHHHHHHHHTTCEEEEEE-GGGHHHHHHHHHHTT-EEEESTTT-SEEETTEE-S-HHHHHHHHHHHHHHTT-EB--HHHHHHHCT. CS
              BKACE 184 penll.flkemadrlpegawsvagigraqlplaaaalalGghvRvGlEDnlylkkgelaksNaelVeravriarelgreiatpaeaReilgL 274
                        p+nl+ ++++  +++p  +w+vagigr ++p    a+  Ggh+R+G+EDn++++kg+ a+sNa+lV+r++ria+e+gr++atp++aReil L
  SwissProt::B0VHH0 183 PKNLMyMMEHLKEEIPTATWAVAGIGRWHIPTSLIAMVTGGHIRCGFEDNIFYHKGVIAESNAQLVARLARIAKEIGRPLATPEQAREILAL 274
                        *****7777777778*99***********************************************************************986 PP



Or compare SwissProt::B0VHH0 to CDD or PaperBLAST