PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS193157 to PF05853 (BKACE)

VIMSS193157 has 272 amino acids

Query:       BKACE  [M=274]
Accession:   PF05853.12
Description: beta-keto acid cleavage enzyme
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   7.3e-110  352.6   0.1   8.2e-110  352.5   0.1    1.0  1  VIMSS193157  


Domain annotation for each sequence (and alignments):
>> VIMSS193157  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  352.5   0.1  8.2e-110  8.2e-110       1     274 []       4     270 ..       4     270 .. 0.98

  Alignments for each domain:
  == domain 1  score: 352.5 bits;  conditional E-value: 8.2e-110
                  SB-EEEE-S-SSS-CCC-TTS--SHHHHHHHHHHHHHHTESEEEE-EE-TTTS-EE--HHHHHHHHHHHHHHHTTSEEEE-SSTTTTG-HHHHHTHHH CS
        BKACE   1 kviitvavtGavttkednpavPvtpeeiaeeaveaaeaGAaivHlHaRdpedgrpsldpelyrevlarirekepdviinlttggastmsaeerlavle 98 
                  k+iit+a+ Ga +tke+npavP+t+eeia+ea  a++aGA+i+HlH+R+ +dg+p++d+e++r+++++irek+pdvii+++tgga+ m++ erl+++e
  VIMSS193157   4 KLIITAAICGAEVTKEHNPAVPYTVEEIAREAESAYKAGASIIHLHVRE-DDGTPTQDKERFRKCIEAIREKCPDVIIQPSTGGAVGMTDLERLQPTE 100
                  89***********************************************.99********************************************** PP

                  HH--SEEEEE-S-EEEB-SGCEE---HHHHHHHHHHHHHTT-EEEEEESSHHHHHHHHHHHHTTSS-SSEEEEEEE--CTS--S-HHHHHHHHHHHHH CS
        BKACE  99 alkpemasldlgslnfglkdlvfentpedieellrrmaeagvkpeievfdvghlrnvkrlieeGllkgpllvqfvlgvpggapatpenllflkemadr 196
                  + +pema+ld+g++nfg +d++f nt+++i+++ + + e+gvkpeievfd g+++ + r+ ++G++++p++++fvlgv+  + a++++l+f   m ++
  VIMSS193157 101 L-HPEMATLDCGTCNFG-GDEIFVNTENTIKNFGKILIERGVKPEIEVFDKGMIDYAIRYQKQGFIQKPMHFDFVLGVQ--MSASARDLVF---MSES 191
                  9.9*************7.899********************************************************96..88999****9...6677 PP

                  HTTC.EEEEEE-GGGHHHHHHHHHHTT-EEEESTTT-SEEETTEE-S-HHHHHHHHHHHHHHTT-EB--HHHHHHHCT. CS
        BKACE 197 lpeg.awsvagigraqlplaaaalalGghvRvGlEDnlylkkgelaksNaelVeravriarelgreiatpaeaReilgL 274
                  +peg +w+vag+gr+q+++aa a+ +GghvRvG+EDn+y++kg laksN+elVer+vr+a+elgreiatp+eaR+il L
  VIMSS193157 192 IPEGsTWTVAGVGRHQFQMAALAIVMGGHVRVGFEDNVYIDKGILAKSNGELVERVVRLAKELGREIATPDEARQILSL 270
                  787967**********************************************************************986 PP



Or compare VIMSS193157 to CDD or PaperBLAST