PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS33491 to PF05853 (BKACE)

VIMSS33491 has 272 amino acids

Query:       BKACE  [M=274]
Accession:   PF05853.12
Description: beta-keto acid cleavage enzyme
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    2.6e-91  291.8   0.2    2.9e-91  291.6   0.2    1.0  1  VIMSS33491  


Domain annotation for each sequence (and alignments):
>> VIMSS33491  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  291.6   0.2   2.9e-91   2.9e-91       2     274 .]       3     268 ..       2     268 .. 0.98

  Alignments for each domain:
  == domain 1  score: 291.6 bits;  conditional E-value: 2.9e-91
                 B-EEEE-S-SSS-CCC-TTS--SHHHHHHHHHHHHHHTESEEEE-EE-TTTS-EE--HHHHHHHHHHHHHHHTTSEEEE-SSTTTTG-HHHHHTHHHHH CS
       BKACE   2 viitvavtGavttkednpavPvtpeeiaeeaveaaeaGAaivHlHaRdpedgrpsldpelyrevlarirekepdviinlttggastmsaeerlavleal 100
                 ++itva+tG+++tk+dnpa+P++peeia+++ +a+ aGAa++H+H Rd e++rp+ dp++ r++++ i e ++ ++i+l+tg + t+ +e+r + +e+ 
  VIMSS33491   3 IVITVAPTGPIATKADNPALPTSPEEIATAVEQAYHAGAAVAHIHLRD-ENERPTADPNIARRAMDLIGE-RCPILIQLSTGVGLTVPFEQREQLVEL- 98 
                 79**********************************************.89*******************.8**********8889999***999999. PP

                 --SEEEEE-S-EEEB-SGCEE---HHHHHHHHHHHHHTT-EEEEEESSHHHHHHHHHHHHTTSS-SSEEEEEEE--CTS--S-HHHHHHHHHHHHHHTT CS
       BKACE 101 kpemasldlgslnfglkdlvfentpedieellrrmaeagvkpeievfdvghlrnvkrlieeGllkgpllvqfvlgvpggapatpenllflkemadrlpe 199
                 +p ma+l++ s+ f  +   f+n+p+ +++l++rm+e+++kpe+e++d+ghl+ + rl++e ll +pl +++vlgv gg+ at++nll    m++rlp+
  VIMSS33491  99 RPRMATLNPCSMSF--GAGEFRNPPQAVRRLAARMRELDIKPELEIYDTGHLEACLRLWAEDLLAEPLQFSIVLGVRGGMAATADNLLT---MVRRLPP 192
                 **************..6777********************************************************************5...9****99 PP

                 CE.EEEEE-GGGHHHHHHHHHHTT-EEEESTTT-SEEETTEE-S-HHHHHHHHHHHHHHTT-EB--HHHHHHHCT. CS
       BKACE 200 ga.wsvagigraqlplaaaalalGghvRvGlEDnlylkkgelaksNaelVeravriarelgreiatpaeaReilgL 274
                 ga w+v++ig+a ++l+a++lalGg+ RvGlED+lyl+kgela+sN +lV r+ r+a++l+++ia+ +ea + l+L
  VIMSS33491 193 GAiWQVIAIGKANMELTAMGLALGGNARVGLEDTLYLRKGELAPSNLALVSRTIRLAEALDLPIASVEEAEAALQL 268
                 *66********************************************************************99986 PP



Or compare VIMSS33491 to CDD or PaperBLAST