PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS3684076 to PF05853 (BKACE)

VIMSS3684076 has 285 amino acids

Query:       BKACE  [M=274]
Accession:   PF05853.12
Description: beta-keto acid cleavage enzyme
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    6.1e-67  211.9   1.1    6.9e-67  211.7   1.1    1.0  1  VIMSS3684076  


Domain annotation for each sequence (and alignments):
>> VIMSS3684076  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  211.7   1.1   6.9e-67   6.9e-67       1     272 [.      18     284 ..      18     285 .] 0.96

  Alignments for each domain:
  == domain 1  score: 211.7 bits;  conditional E-value: 6.9e-67
                   SB-EEEE-S-SSS-CCC-TTS--SHHHHHHHHHHHHHHTESEEEE-EE-TTTS-EE--HHHHHHHHHHHHH.HHTTSEEEE-SSTTTTG-HHHHHTH CS
         BKACE   1 kviitvavtGavttkednpavPvtpeeiaeeaveaaeaGAaivHlHaRdpedgrpsldpelyrevlarire.kepdviinlttggastmsaeerlav 96 
                   ++i+  a++Ga+++k+d+pa+P+t +eia++a+e aeaGAa +H+H+Rd ++gr+ ld++ yr+v+a+ir+     +++++t+++a   +a+e++av
  VIMSS3684076  18 PLILANAPNGATRSKADHPALPITESEIARTAAEIAEAGAALIHVHVRD-AQGRHLLDAQAYRAVTAAIRAeVGDRLVVQITSEAAGRYEAPEQMAV 113
                   6899*********************************************.88*******************77888********9999999****** PP

                   HHHH--SEEEEE-S-EEEB-SGCEE---HHHHHHHHHHHHHTT-EEEEEESSHHHHHHHHHHHHTTSS-.SSEEEEEEE-.-CTS--S-HHHHH.HH CS
         BKACE  97 lealkpemasldlgslnfglkdlvfentpedieellrrmaeagvkpeievfdvghlrnvkrlieeGllk.gpllvqfvlg.vpggapatpenll.fl 190
                   ++a++pe++sl+l+++     d   +  ++ +++++++ +++ v  +i+v++++++ ++++l ++G+l  g  +  fvlg ++ g+ ++p++ll fl
  VIMSS3684076 114 VRATRPEAVSLALREIVP---D---AGAETAAAAFFTWARRERVLLQIIVYEPAEVARYADLKSRGVLGeGGDFPLFVLGrYTPGQVSRPADLLpFL 204
                   ***************999...4...56788999***********************************96778889******************998 PP

                   HHHHHHHTTCEEEEEE-GGGHHHHHHHHHHTT-EEEESTTT-SEEETTEE-S-HHHHHHHHHHHHHHTT-EB--HHHHHHHC CS
         BKACE 191 kemadrlpegawsvagigraqlplaaaalalGghvRvGlEDnlylkkgelaksNaelVeravriarelgreiatpaeaReil 272
                   ++  + +p   ws++++g+++ ++a  a+ lGghvRvG+E++l  ++g++a+sNa++++ra++ ar lgr++a+++ aR+++
  VIMSS3684076 205 AASGEGVP--LWSICAFGPRENACALVAAGLGGHVRVGFENSLLAPDGRPAESNAAQIRRAAEGARLLGRPLADADTARALM 284
                   88888777..8********************************************************************987 PP



Or compare VIMSS3684076 to CDD or PaperBLAST