PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS40697 to PF05853 (BKACE)

VIMSS40697 has 251 amino acids

Query:       BKACE  [M=274]
Accession:   PF05853.12
Description: beta-keto acid cleavage enzyme
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    1.8e-30   92.3   0.3    4.7e-30   90.9   0.3    1.6  1  VIMSS40697  


Domain annotation for each sequence (and alignments):
>> VIMSS40697  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   90.9   0.3   4.7e-30   4.7e-30       4     262 ..       4     243 ..       3     251 .] 0.85

  Alignments for each domain:
  == domain 1  score: 90.9 bits;  conditional E-value: 4.7e-30
                 EEEE-S-SSS-CCC-TTS--SHHHHHHHHHHHHHHTESEEEE-EE-TTTS-EE--HHHHHHHHHHHHHHHTTSEEEE-SSTTTTG-HHHHHTHHHHH-- CS
       BKACE   4 itvavtGavttkednpavPvtpeeiaeeaveaaeaGAaivHlHaRdpedgrpsldpelyrevlarirekepdviinlttggastmsaeerlavlealkp 102
                 ++v+++Ga ++++++pavP tp+e+ +++++ + aGA + HlH+ +   g+++l pe ++++l++ir+ +pd+ + ++t  +  ++++er + ++    
  VIMSS40697   4 LQVCLNGA-RSQAEHPAVPHTPAELTRDVAQLFAAGARAFHLHVYR--GGQQTLAPEAVADTLHAIRAVCPDAELAISTAEGIAATPAERARLVAGW-- 97 
                 6899**97.9999********************************9..5*******************************55566667777766662.. PP

                 SEEEEE-S-EEEB-SGCEE---HHHHHHHHHHHHHTT-EEEEEESSHHHHHHHHHHHHTTSS-SSEEEEEEE--CTS--S-HHHHH.HHHHHHHHHTTC CS
       BKACE 103 emasldlgslnfglkdlvfentpedieellrrmaeagvkpeievfdvghlrnvkrlieeGllkgpllvqfvlgvpggapatpenll.flkemadrlpeg 200
                  +a  d+  +n+         +++ i+++l+  +++gv  e  ++ +++++++++l       +++l++ + g p  a+a+   ll +l++  + lp  
  VIMSS40697  98 -TAWPDTLCVNL---------SETGIDDVLALAEARGVALEAGLWTPADVQKFRTLQHL--SWRRVLLEPLSGDPDTAHAELTILLgALNDFRPDLP-- 182
                 .23334444444.........6678899**********************998888654..457788888888888888888888877777777776.. PP

                 EEEEEE-GGGHHHHHHHHHHTT-EEEESTTT-SEEETTEE-S-HHHHHHHHHHHHHHTT-EB CS
       BKACE 201 awsvagigraqlplaaaalalGghvRvGlEDnlylkkgelaksNaelVeravriarelgrei 262
                    ++gi +a +pl+ +a+alG + R+G+ED l l+++++ + N +l ++ +r++r+ + e 
  VIMSS40697 183 -RLAHGIDDATWPLLRRAAALGFESRIGFEDVLTLPDQSTPAGNLDLYQAGRRLMRAGEAEA 243
                 .899************************************99********999999877765 PP



Or compare VIMSS40697 to CDD or PaperBLAST