PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS540055 to PF05853 (BKACE)

VIMSS540055 has 207 amino acids

Query:       BKACE  [M=274]
Accession:   PF05853.12
Description: beta-keto acid cleavage enzyme
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    5.9e-63  198.8   0.0      7e-63  198.5   0.0    1.0  1  VIMSS540055  


Domain annotation for each sequence (and alignments):
>> VIMSS540055  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  198.5   0.0     7e-63     7e-63       2     200 ..       3     193 ..       2     202 .. 0.96

  Alignments for each domain:
  == domain 1  score: 198.5 bits;  conditional E-value: 7e-63
                  B-EEEE-S-SSS-CCC-TTS--SHHHHHHHHHHHHHHTESEEEE-EE-TTTS-EE--HHHHHHHHHHHHHHHTTSEEEE-SSTTTTG-HHHHHTHHHH CS
        BKACE   2 viitvavtGavttkednpavPvtpeeiaeeaveaaeaGAaivHlHaRdpedgrpsldpelyrevlarirekepdviinlttggastmsaeerlavlea 99 
                  ++itva+tG+++tk+dnpa+P++peeia+++ +a+ aGAa++H+H Rd e++rp+ dp++ r++++ i e ++ ++i+l+tg + t+ +e+r + +e+
  VIMSS540055   3 IVITVAPTGPIATKADNPALPTSPEEIATAVEQAYHAGAAVAHIHLRD-ENERPTADPNIARRAMDLIGE-RCPILIQLSTGVGLTVPFEQREQLVEL 98 
                  79**********************************************.89*******************.8**********8889999***999999 PP

                  H--SEEEEE-S-EEEB-SGCEE---HHHHHHHHHHHHHTT-EEEEEESSHHHHHHHHHHHHTTSS-SSEEEEEEE--CTS--S-HHHHHHHHHHHHHH CS
        BKACE 100 lkpemasldlgslnfglkdlvfentpedieellrrmaeagvkpeievfdvghlrnvkrlieeGllkgpllvqfvlgvpggapatpenllflkemadrl 197
                   +p ma+l++ s+ f  +   f+n+p+ +++l++rm+e+++kpe+e++d+ghl+ + rl++e ll +pl +++vlgv gg+ at++nll    m++rl
  VIMSS540055  99 -RPRMATLNPCSMSF--GAGEFRNPPQAVRRLAARMRELDIKPELEIYDTGHLEACLRLWAEDLLAEPLQFSIVLGVRGGMAATADNLLT---MVRRL 190
                  .**************..6777********************************************************************5...88888 PP

                  TTC CS
        BKACE 198 peg 200
                  p+g
  VIMSS540055 191 PPG 193
                  765 PP



Or compare VIMSS540055 to CDD or PaperBLAST