PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS562379 to PF05853 (BKACE)

VIMSS562379 has 273 amino acids

Query:       BKACE  [M=274]
Accession:   PF05853.12
Description: beta-keto acid cleavage enzyme
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   3.6e-106  340.5   0.1     4e-106  340.4   0.1    1.0  1  VIMSS562379  


Domain annotation for each sequence (and alignments):
>> VIMSS562379  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  340.4   0.1    4e-106    4e-106       1     274 []       3     271 ..       3     271 .. 0.98

  Alignments for each domain:
  == domain 1  score: 340.4 bits;  conditional E-value: 4e-106
                  SB-EEEE-S-SSS-CCC-TTS--SHHHHHHHHHHHHHHTESEEEE-EE-TTTS-EE--HHHHHHHHHHHHHHHTTSEEEE-SSTTTTG-HHHHHTHHH CS
        BKACE   1 kviitvavtGavttkednpavPvtpeeiaeeaveaaeaGAaivHlHaRdpedgrpsldpelyrevlarirekepdviinlttggastmsaeerlavle 98 
                  k+iit+a+ Ga + ke+npavP+t+ee ++ea  a++aGA+i+HlH+R  +dg+p++d ++++ev+++i++ +pdvii+++tgga+ m+ +erl+++e
  VIMSS562379   3 KMIITAAICGAEVLKEHNPAVPYTVEECVREAKSAYDAGASIIHLHVRY-DDGTPTQDRNRFKEVMEAIKAVCPDVIIQPSTGGAVGMTNDERLQPTE 99 
                  79***********************************************.99********************************************** PP

                  HH--SEEEEE-S-EEEB-SGCEE---HHHHHHHHHHHHHTT-EEEEEESSHHHHHHHHHHHHTTSS-SSEEEEEEE--CTS--S-HHHHHHHHHHHHH CS
        BKACE  99 alkpemasldlgslnfglkdlvfentpedieellrrmaeagvkpeievfdvghlrnvkrlieeGllkgpllvqfvlgvpggapatpenllflkemadr 196
                  ++ pema+ld+g+lnfg +d+vf+nt+++i+ + ++m e+g+kpe+evfd ++++ + rl+++G++++p++++fv+gv+gg+  ++++++fl+e    
  VIMSS562379 100 LF-PEMATLDCGTLNFG-GDEVFTNTENTIKYFGEKMIERGIKPELEVFDKSMIDMALRLHRKGYIQSPMHFDFVMGVNGGISGEMRDFVFLRES--- 192
                  *5.*************7.899**********************************************************************6555... PP

                  HTTC.EEEEEE-GGGHHHHHHHHHHTT-EEEESTTT-SEEETTEE-S-HHHHHHHHHHHHHHTT-EB--HHHHHHHCT. CS
        BKACE 197 lpeg.awsvagigraqlplaaaalalGghvRvGlEDnlylkkgelaksNaelVeravriarelgreiatpaeaReilgL 274
                  +p++ +++vag+gr ++plaa a+  GghvRvG+EDn+y++kg+la+sN+elVe++vr+a+e+greiatpaeaR+ilgL
  VIMSS562379 193 IPADaTYTVAGVGRYEFPLAALAIIDGGHVRVGFEDNVYISKGVLARSNGELVEKVVRMAKEMGREIATPAEARRILGL 271
                  566857***********************************************************************97 PP



Or compare VIMSS562379 to CDD or PaperBLAST