PaperBLAST – Find papers about a protein or its homologs

 

Align reanno::Burk376:H281DRAFT_00641 to PF05853 (BKACE)

reanno::Burk376:H281DRAFT_00641 has 312 amino acids

Query:       BKACE  [M=274]
Accession:   PF05853.12
Description: beta-keto acid cleavage enzyme
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                        Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                        -----------
   1.4e-110  355.0   0.0   1.6e-110  354.8   0.0    1.0  1  reanno::Burk376:H281DRAFT_00641  


Domain annotation for each sequence (and alignments):
>> reanno::Burk376:H281DRAFT_00641  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  354.8   0.0  1.6e-110  1.6e-110       1     274 []       7     304 ..       7     304 .. 0.96

  Alignments for each domain:
  == domain 1  score: 354.8 bits;  conditional E-value: 1.6e-110
                                      SB-EEEE-S-SSS-CCC-TTS--SHHHHHHHHHHHHHHTESEEEE-EE-TTTS-EE--HHHHHHHHHHHHHHHTTSEE CS
                            BKACE   1 kviitvavtGavttkednpavPvtpeeiaeeaveaaeaGAaivHlHaRdpedgrpsldpelyrevlarirekepdvii 78 
                                      kvii++a+tGa++ +++++ +P+tpe+i ++a+eaa+aGAai+HlHaRdp dgrp+ +pe++++++ +i+e ++d++i
  reanno::Burk376:H281DRAFT_00641   7 KVIISCAITGATHVPSMSEFLPITPEQIRDQAIEAAQAGAAIIHLHARDPVDGRPTPSPEIFKAFVPAIAE-ATDAVI 83 
                                      8**********************************************************************.8***** PP

                                      EE-SSTTTTG-HHHHHTHHHHH--SEEEEE-S-EEEB-......................SGCEE---HHHHHHHHHH CS
                            BKACE  79 nlttggastmsaeerlavlealkpemasldlgslnfgl......................kdlvfentpedieellrr 134
                                      n+ttgg++ m+ eerla  ++ +pem+sl++gs+nf++                      +d++f+nt++di+++l +
  reanno::Burk376:H281DRAFT_00641  84 NITTGGSTRMTLEERLAYPRLARPEMCSLNMGSMNFSIhpvaakisswrygwekdyiegmEDMIFRNTFRDIRNILLE 161
                                      ************************************9988887777776666655555555***************** PP

                                      HHHTT-EEEEEESSHHHHHHHHHHHHTTSS-SSEEEEEEE--CTS--S-HHHHHHHHHHHHHH.TTC..EEEEEE-GG CS
                            BKACE 135 maeagvkpeievfdvghlrnvkrlieeGllkgpllvqfvlgvpggapatpenllflkemadrl.peg..awsvagigr 209
                                      + e+g+++e+e++dvghl+n+++++++Gl+k+p+++q v+g+ gg +a+pen+l+++++adrl +++  ++sv+g+gr
  reanno::Burk376:H281DRAFT_00641 162 LGESGTRFEFECYDVGHLYNLAHFVDQGLVKPPFFIQSVFGILGGLGADPENMLLMRSTADRLfGREnyHFSVLGAGR 239
                                      **************************************************************99655577******** PP

                                      GHHHHHHHHHHTT-EEEESTTT-SEEETTEE-S-HHHHHHHHHHHHHHTT-EB--HHHHHHHCT. CS
                            BKACE 210 aqlplaaaalalGghvRvGlEDnlylkkgelaksNaelVeravriarelgreiatpaeaReilgL 274
                                      +q+pl+++++ +Gg+vRvGlED++yl+kg++a++Na++V++++ri++el +eiatpa+aR++lgL
  reanno::Burk376:H281DRAFT_00641 240 HQMPLVTMSAIMGGNVRVGLEDSVYLAKGVKAETNAQQVRKIRRILEELSLEIATPADARKMLGL 304
                                      ***************************************************************97 PP



Or compare reanno::Burk376:H281DRAFT_00641 to CDD or PaperBLAST