PaperBLAST – Find papers about a protein or its homologs

 

Align reanno::WCS417:GFF1426 to PF05853 (BKACE)

reanno::WCS417:GFF1426 has 310 amino acids

Query:       BKACE  [M=274]
Accession:   PF05853.12
Description: beta-keto acid cleavage enzyme
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence               Description
    ------- ------ -----    ------- ------ -----   ---- --  --------               -----------
   2.6e-111  357.4   0.0   2.9e-111  357.2   0.0    1.0  1  reanno::WCS417:GFF1426  


Domain annotation for each sequence (and alignments):
>> reanno::WCS417:GFF1426  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  357.2   0.0  2.9e-111  2.9e-111       1     274 []       6     302 ..       6     302 .. 0.96

  Alignments for each domain:
  == domain 1  score: 357.2 bits;  conditional E-value: 2.9e-111
                             SB-EEEE-S-SSS-CCC-TTS--SHHHHHHHHHHHHHHTESEEEE-EE-TTTS-EE--HHHHHHHHHHHHHHHTTSEEEE-SSTTTT CS
                   BKACE   1 kviitvavtGavttkednpavPvtpeeiaeeaveaaeaGAaivHlHaRdpedgrpsldpelyrevlarirekepdviinlttggast 87 
                             +viit+avtGa++t++++p++P+t++eia++a+ aaeaGAaivHlHaRdp+dgrps+dp+l++e+l +i++ ++dv+in+ttgga+t
  reanno::WCS417:GFF1426   6 PVIITCAVTGAIHTPSMSPHLPITAQEIADAAIGAAEAGAAIVHLHARDPNDGRPSQDPALFAEFLPQIKA-ASDVVINITTGGAPT 91 
                             79*********************************************************************.8************** PP

                             G-HHHHHTHHHHH--SEEEEE-S-EEEB-......................SGCEE---HHHHHHHHHHHHHTT-EEEEEESSHHHH CS
                   BKACE  88 msaeerlavlealkpemasldlgslnfgl......................kdlvfentpedieellrrmaeagvkpeievfdvghl 152
                             m +eerl+++ ++kpe+asl++gs+nfgl                      +d++f+nt++di+++l+++ae+ +++eie++d+ghl
  reanno::WCS417:GFF1426  92 MGVEERLQPVMQFKPELASLNMGSMNFGLyemlnrftdfkhdwerpyleesDDRIFRNTFRDITHILNACAENRTRFEIECYDIGHL 178
                             ***************************9988888777776666655555555*********************************** PP

                             HHHHHHHHTTSS-SSEEEEEEE--CTS--S-HHHHHHHHHHHHHH.TTC.EEEEEE-GGGHHHHHHHHHHTT-EEEESTTT-SEEET CS
                   BKACE 153 rnvkrlieeGllkgpllvqfvlgvpggapatpenllflkemadrl.peg.awsvagigraqlplaaaalalGghvRvGlEDnlylkk 237
                             +++++++e+Gllk+pl++q v+g+ gg++ +pe+l++++++adrl +++  ws++g+gr q+pla+++l++G + RvGlED+l+ + 
  reanno::WCS417:GFF1426 179 YTAAHFLERGLLKPPLFIQSVFGLRGGIGGHPEDLAHMRRTADRLfGSDyVWSILGAGRGQIPLATMGLSMGSNARVGLEDSLWDGP 265
                             *********************************************999966************************************ PP

                             TEE-S-HHHHHHHHHHHHHHTT-EB--HHHHHHHCT. CS
                   BKACE 238 gelaksNaelVeravriarelgreiatpaeaReilgL 274
                             g+la+sNa++V+r+++++++lg ++atp+eaReilgL
  reanno::WCS417:GFF1426 266 GKLAASNADQVRRIRTVIEALGHRVATPDEAREILGL 302
                             ***********************************97 PP



Or compare reanno::WCS417:GFF1426 to CDD or PaperBLAST