PaperBLAST – Find papers about a protein or its homologs

 

Align reanno::pseudo6_N2E2:Pf6N2E2_4692 to PF05853 (BKACE)

reanno::pseudo6_N2E2:Pf6N2E2_4692 has 295 amino acids

Query:       BKACE  [M=274]
Accession:   PF05853.12
Description: beta-keto acid cleavage enzyme
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                          -----------
   8.9e-103  329.4   0.0     1e-102  329.2   0.0    1.0  1  reanno::pseudo6_N2E2:Pf6N2E2_4692  


Domain annotation for each sequence (and alignments):
>> reanno::pseudo6_N2E2:Pf6N2E2_4692  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  329.2   0.0    1e-102    1e-102       2     274 .]       5     291 ..       4     291 .. 0.94

  Alignments for each domain:
  == domain 1  score: 329.2 bits;  conditional E-value: 1e-102
                                        B-EEEE-S-SSS-CCC-TTS--SHHHHHHHHHHHHHHTESEEEE-EE-TTTS-EE--HHHHHHHHHHHHHHHTTSE CS
                              BKACE   2 viitvavtGavttkednpavPvtpeeiaeeaveaaeaGAaivHlHaRdpedgrpsldpelyrevlarirekepdvi 77 
                                        viit+a+tGa +t +++p+vPvtp++ia++a+eaa+aGA++vH+H+Rdp++g+ s+d++lyrev++rire+++d+i
  reanno::pseudo6_N2E2:Pf6N2E2_4692   5 VIITCALTGAGDTTAKSPHVPVTPKQIADAAIEAAKAGATVVHCHVRDPQTGKFSRDVALYREVMERIREADVDII 80 
                                        9*************************************************************************** PP

                                        EEE-SS.........TTTTG-HHH...............HHTHHHHH--SEEEEE-S-EEEB-SGCEE---HHHHH CS
                              BKACE  78 inlttg.........gastmsaee...............rlavlealkpemasldlgslnfglkdlvfentpedie 129
                                        +nlt g         g+      +               rla++e+l pe+++ld+g+lnfg +d+++ +tp++++
  reanno::pseudo6_N2E2:Pf6N2E2_4692  81 VNLTAGmggdleigaGE------QpmefgpntdlvgpltRLAHVEELLPEICTLDCGTLNFGDGDTIYVSTPAQLR 150
                                        ******77666666522......2333344466677777************************************* PP

                                        HHHHHHHHTT-EEEEEESSHHHHHHHHHHHHTTSS-SSEEEEEEE--CTS--S-HHHHHHHHHHHHHHTTCE.EEE CS
                              BKACE 130 ellrrmaeagvkpeievfdvghlrnvkrlieeGllkgpllvqfvlgvpggapatpenllflkemadrlpega.wsv 204
                                        + ++r++e+gvk e+e+fd+ghl+ +k+li+eGll++pl +q++lg+p+gapa+  ++++   m+d+lp++a w+ 
  reanno::pseudo6_N2E2:Pf6N2E2_4692 151 AGAKRITELGVKAELEIFDTGHLWFAKQLIKEGLLDNPL-FQLCLGIPWGAPADTTTMKA---MVDNLPADAvWAG 222
                                        ***********************************9875.8******************5...9*******66*** PP

                                        EE-GGGHHHHHHHHHHTT-EEEESTTT-SEEETTEE-S-HHHHHHHHHHHHHHTT-EB--HHHHHHHCT. CS
                              BKACE 205 agigraqlplaaaalalGghvRvGlEDnlylkkgelaksNaelVeravriarelgreiatpaeaReilgL 274
                                        +gigr q+p+aa+a++lGg+vRvGlEDnl+l+kg+la +N++lVera +i+ +lg ++ tpae R+ +gL
  reanno::pseudo6_N2E2:Pf6N2E2_4692 223 FGIGRMQMPMAAQAVLLGGNVRVGLEDNLWLDKGVLA-TNGQLVERAGEILSRLGARVLTPAEGRKKMGL 291
                                        *************************************.****************************9997 PP



Or compare reanno::pseudo6_N2E2:Pf6N2E2_4692 to CDD or PaperBLAST