PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::P0ADQ7 to PF05957 (DUF883)

SwissProt::P0ADQ7 has 109 amino acids

Query:       DUF883  [M=94]
Accession:   PF05957.13
Description: Bacterial protein of unknown function (DUF883)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    3.2e-29   87.7   1.0    3.8e-29   87.5   1.0    1.0  1  SwissProt::P0ADQ7  


Domain annotation for each sequence (and alignments):
>> SwissProt::P0ADQ7  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   87.5   1.0   3.8e-29   3.8e-29       2      94 .]      16     107 ..      15     107 .. 0.96

  Alignments for each domain:
  == domain 1  score: 87.5 bits;  conditional E-value: 3.8e-29
             DUF883   2 eleaeleslladleellkeaadeageeaeelRerleerlerarerlrdaeeavaerakeaaeaaddyVrenPwqavGiAagvGlllGlLlar 93 
                        ++++++++l ++le++lk+++++a+ eae++R+++++ l+++r+r++    +v++ a++a+ +ad++Vre+Pw++vG Aa+vG+ +G+Ll+ 
  SwissProt::P0ADQ7  16 DIQNDVNQLADSLESVLKSWGSDAKGEAEAARSKAQALLKETRARMHGR-TRVQQAARDAVGCADSFVRERPWCSVGTAAAVGIFIGALLSM 106
                        799********************************************65.55**************************************98 PP

             DUF883  94 R 94 
                        R
  SwissProt::P0ADQ7 107 R 107
                        7 PP



Or compare SwissProt::P0ADQ7 to CDD or PaperBLAST