SwissProt::P0ADQ7 has 109 amino acids
Query: DUF883 [M=53]
Accession: PF05957.17
Description: DUF883 N-terminal domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.3e-18 53.0 2.8 1.5e-18 52.8 2.2 1.4 1 SwissProt::P0ADQ7
Domain annotation for each sequence (and alignments):
>> SwissProt::P0ADQ7
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 52.8 2.2 1.5e-18 1.5e-18 1 48 [. 15 62 .. 15 70 .. 0.96
Alignments for each domain:
== domain 1 score: 52.8 bits; conditional E-value: 1.5e-18
DUF883 1 ekliddlksLladleeLLksaadeageeadeLRerledrLkraRerls 48
+++++d+++L ++le++Lks++++a+ ea+++R+++++ Lk++R+r++
SwissProt::P0ADQ7 15 QDIQNDVNQLADSLESVLKSWGSDAKGEAEAARSKAQALLKETRARMH 62
689*******************************************97 PP
Or compare SwissProt::P0ADQ7 to CDD or PaperBLAST