PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS149634 to PF05957 (DUF883)

VIMSS149634 has 103 amino acids

Query:       DUF883  [M=53]
Accession:   PF05957.17
Description: DUF883 N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
      1e-12   34.1   3.2    1.6e-12   33.5   3.2    1.3  1  VIMSS149634  


Domain annotation for each sequence (and alignments):
>> VIMSS149634  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   33.5   3.2   1.6e-12   1.6e-12       3      52 ..      12      61 ..      10      62 .. 0.94

  Alignments for each domain:
  == domain 1  score: 33.5 bits;  conditional E-value: 1.6e-12
       DUF883  3 liddlksLladleeLLksaadeageeadeLRerledrLkraRerlsdaqd 52
                 + ddl  L ++lee+L+s++d a++++ eL++r+e++L++++ r s+a d
  VIMSS149634 12 VDDDLTLLSETLEEVLRSSGDPADQKYIELKARAEQALEEVKNRVSHASD 61
                 679****************************************9999987 PP



Or compare VIMSS149634 to CDD or PaperBLAST