VIMSS149634 has 103 amino acids
Query: DUF883 [M=53] Accession: PF05957.17 Description: DUF883 N-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-12 34.1 3.2 1.6e-12 33.5 3.2 1.3 1 VIMSS149634 Domain annotation for each sequence (and alignments): >> VIMSS149634 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 33.5 3.2 1.6e-12 1.6e-12 3 52 .. 12 61 .. 10 62 .. 0.94 Alignments for each domain: == domain 1 score: 33.5 bits; conditional E-value: 1.6e-12 DUF883 3 liddlksLladleeLLksaadeageeadeLRerledrLkraRerlsdaqd 52 + ddl L ++lee+L+s++d a++++ eL++r+e++L++++ r s+a d VIMSS149634 12 VDDDLTLLSETLEEVLRSSGDPADQKYIELKARAEQALEEVKNRVSHASD 61 679****************************************9999987 PP
Or compare VIMSS149634 to CDD or PaperBLAST