PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS149634 to PF05957 (DUF883)

VIMSS149634 has 103 amino acids

Query:       DUF883  [M=94]
Accession:   PF05957.13
Description: Bacterial protein of unknown function (DUF883)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.7e-32   98.2   0.2    1.9e-32   98.1   0.2    1.0  1  VIMSS149634  


Domain annotation for each sequence (and alignments):
>> VIMSS149634  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   98.1   0.2   1.9e-32   1.9e-32       2      94 .]      11     103 .]      10     103 .] 0.98

  Alignments for each domain:
  == domain 1  score: 98.1 bits;  conditional E-value: 1.9e-32
       DUF883   2 eleaeleslladleellkeaadeageeaeelRerleerlerarerlrdaeeavaerakeaaeaaddyVrenPwqavGiAagvGlllGlLlarR 94 
                  ++ ++l  l ++lee+l++++d a++++ el++r+e++le++++r+++a++++  rak+a+ +addyV+e+Pwq +G++a+vGl+lGlLlarR
  VIMSS149634  11 RVDDDLTLLSETLEEVLRSSGDPADQKYIELKARAEQALEEVKNRVSHASDSYYYRAKQAVYKADDYVHEKPWQGIGVGAAVGLVLGLLLARR 103
                  57899***************************************************************************************9 PP



Or compare VIMSS149634 to CDD or PaperBLAST