PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS16373 to PF05957 (DUF883)

VIMSS16373 has 101 amino acids

Query:       DUF883  [M=94]
Accession:   PF05957.13
Description: Bacterial protein of unknown function (DUF883)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    6.7e-33   99.5   0.3    7.4e-33   99.4   0.3    1.0  1  VIMSS16373  


Domain annotation for each sequence (and alignments):
>> VIMSS16373  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   99.4   0.3   7.4e-33   7.4e-33       3      94 .]      10     101 .]       8     101 .] 0.98

  Alignments for each domain:
  == domain 1  score: 99.4 bits;  conditional E-value: 7.4e-33
      DUF883   3 leaeleslladleellkeaadeageeaeelRerleerlerarerlrdaeeavaerakeaaeaaddyVrenPwqavGiAagvGlllGlLlarR 94 
                 + ++l  l ++lee+l++++d a++++ el++r+e++l+++++r+++a++++  rak+a+ +addyV+e+Pwq +G++a+vGl+lGlLlarR
  VIMSS16373  10 IDDDLTLLSETLEEVLRSSGDPADQKYVELKARAEKALDDVKKRVSQASDSYYYRAKQAVYRADDYVHEKPWQGIGVGAAVGLVLGLLLARR 101
                 7899***************************************************************************************9 PP



Or compare VIMSS16373 to CDD or PaperBLAST