PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS16762 to PF05957 (DUF883)

VIMSS16762 has 113 amino acids

Query:       DUF883  [M=94]
Accession:   PF05957.13
Description: Bacterial protein of unknown function (DUF883)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    3.6e-29   87.6   1.0    4.3e-29   87.3   1.0    1.0  1  VIMSS16762  


Domain annotation for each sequence (and alignments):
>> VIMSS16762  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   87.3   1.0   4.3e-29   4.3e-29       2      94 .]      20     111 ..      19     111 .. 0.96

  Alignments for each domain:
  == domain 1  score: 87.3 bits;  conditional E-value: 4.3e-29
      DUF883   2 eleaeleslladleellkeaadeageeaeelRerleerlerarerlrdaeeavaerakeaaeaaddyVrenPwqavGiAagvGlllGlLlarR 94 
                 ++++++++l ++le++lk+++++a+ eae++R+++++ l+++r+r++    +v++ a++a+ +ad++Vre+Pw++vG Aa+vG+ +G+Ll+ R
  VIMSS16762  20 DIQNDVNQLADSLESVLKSWGSDAKGEAEAARSKAQALLKETRARMHGR-TRVQQAARDAVGCADSFVRERPWCSVGTAAAVGIFIGALLSMR 111
                 799********************************************65.55**************************************987 PP



Or compare VIMSS16762 to CDD or PaperBLAST