PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS17173 to PF05957 (DUF883)

VIMSS17173 has 101 amino acids

Query:       DUF883  [M=94]
Accession:   PF05957.13
Description: Bacterial protein of unknown function (DUF883)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    7.8e-34  102.5   1.5    8.8e-34  102.4   1.5    1.0  1  VIMSS17173  


Domain annotation for each sequence (and alignments):
>> VIMSS17173  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  102.4   1.5   8.8e-34   8.8e-34       2      94 .]       9     101 .]       8     101 .] 0.99

  Alignments for each domain:
  == domain 1  score: 102.4 bits;  conditional E-value: 8.8e-34
      DUF883   2 eleaeleslladleellkeaadeageeaeelRerleerlerarerlrdaeeavaerakeaaeaaddyVrenPwqavGiAagvGlllGlLlarR 94 
                  l+ael+sl ++lee+l++++++++ee++++R+++e++l+++r rl ++ +a+a++++ aa++ad+yVrenPw+ vGi+a++G++lG+Ll+rR
  VIMSS17173   9 HLRAELKSLSDTLEEVLSSSGEKSKEELSKIRSKAEQALKQSRYRLGETGDAIAKQTRVAAARADEYVRENPWTGVGIGAAIGVVLGVLLSRR 101
                 689*****************************************************************************************9 PP



Or compare VIMSS17173 to CDD or PaperBLAST