PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1921569 to PF05957 (DUF883)

VIMSS1921569 has 129 amino acids

Query:       DUF883  [M=94]
Accession:   PF05957.13
Description: Bacterial protein of unknown function (DUF883)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.8e-27   82.1   6.3    3.7e-27   81.1   2.1    2.0  2  VIMSS1921569  


Domain annotation for each sequence (and alignments):
>> VIMSS1921569  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !    4.6   0.2    0.0028    0.0028      36      65 ..       7      36 ..       1      42 [. 0.41
   2 !   81.1   2.1   3.7e-27   3.7e-27       2      94 .]      39     128 ..      38     129 .] 0.95

  Alignments for each domain:
  == domain 1  score: 4.6 bits;  conditional E-value: 0.0028
        DUF883 36 leerlerarerlrdaeeavaerakeaaeaa 65
                  +e +l+r  +++r++ ++v + +++aa++ 
  VIMSS1921569  7 IEHKLDRGLSEIRRTGRRVGRTTRSAAHDL 36
                  334444444444444444444444444333 PP

  == domain 2  score: 81.1 bits;  conditional E-value: 3.7e-27
        DUF883   2 eleaeleslladleellkeaadeageeaeelRerleerlerarerlrdaeeavaerakeaaeaaddyVrenPwqavGiAagvGlllGlLlarR 94 
                   +++++l+ l+++le+llk+   +++ ++++lR+r+++rl++ar++l+ a+ ++a+r +e ae++ ++V++nPwq++G++ag+++++GlLl+ R
  VIMSS1921569  39 DVTDDLRGLVDELEDLLKN---DGDGDIAALRKRVQARLDEARSTLDYASGTAAARLRESAERVSQAVHDNPWQTAGVVAGLAFVAGLLLSSR 128
                   6789*************55...5679****************************************************************965 PP



Or compare VIMSS1921569 to CDD or PaperBLAST