VIMSS215791 has 162 amino acids
Query: DUF883 [M=53]
Accession: PF05957.17
Description: DUF883 N-terminal domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.9e-17 47.5 4.7 6.9e-17 47.5 4.7 1.8 3 VIMSS215791
Domain annotation for each sequence (and alignments):
>> VIMSS215791
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? -2.8 0.0 0.36 0.36 35 44 .. 32 41 .. 31 43 .. 0.71
2 ! 47.5 4.7 6.9e-17 6.9e-17 1 52 [. 67 118 .. 67 119 .. 0.97
3 ? -3.2 0.1 0.47 0.47 21 30 .. 127 136 .. 125 137 .. 0.63
Alignments for each domain:
== domain 1 score: -2.8 bits; conditional E-value: 0.36
DUF883 35 rledrLkraR 44
++++++++a+
VIMSS215791 32 KVRSHFHAAQ 41
6778888877 PP
== domain 2 score: 47.5 bits; conditional E-value: 6.9e-17
DUF883 1 ekliddlksLladleeLLksaadeageeadeLRerledrLkraRerlsdaqd 52
e+++++++sLl++le+L ++a+ e+++ ++++R+++e++L + R+ lsda++
VIMSS215791 67 ESMEAEIESLLKSLENLKHDASEESQKSVKAIRSNAESALRHSRSLLSDAYE 118
789***********************************************98 PP
== domain 3 score: -3.2 bits; conditional E-value: 0.47
DUF883 21 aadeageead 30
+++++ ++a+
VIMSS215791 127 TGKATRDYAQ 136
6777777776 PP
Or compare VIMSS215791 to CDD or PaperBLAST