VIMSS287466 has 101 amino acids
Query: DUF883 [M=53] Accession: PF05957.17 Description: DUF883 N-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-12 32.6 3.4 5.1e-12 31.9 3.4 1.4 1 VIMSS287466 Domain annotation for each sequence (and alignments): >> VIMSS287466 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 31.9 3.4 5.1e-12 5.1e-12 3 52 .. 10 59 .. 8 60 .. 0.94 Alignments for each domain: == domain 1 score: 31.9 bits; conditional E-value: 5.1e-12 DUF883 3 liddlksLladleeLLksaadeageeadeLRerledrLkraRerlsdaqd 52 + ddl L ++lee+L+s++d a++++ eL++ +e++L++++ r s a d VIMSS287466 10 IDDDLTLLSETLEEVLRSSGDPADQKYVELKAHAEKALDDVKKRVSQASD 59 789****************************************9988776 PP
Or compare VIMSS287466 to CDD or PaperBLAST