PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS57774 to PF05957 (DUF883)

VIMSS57774 has 110 amino acids

Query:       DUF883  [M=53]
Accession:   PF05957.17
Description: DUF883 N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    3.7e-16   45.1   2.6    6.4e-16   44.4   2.6    1.4  1  VIMSS57774  


Domain annotation for each sequence (and alignments):
>> VIMSS57774  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   44.4   2.6   6.4e-16   6.4e-16       2      51 ..      17      66 ..      16      68 .. 0.93

  Alignments for each domain:
  == domain 1  score: 44.4 bits;  conditional E-value: 6.4e-16
      DUF883  2 kliddlksLladleeLLksaadeageeadeLRerledrLkraRerlsdaq 51
                + +++l++Ll++++++L+++a+ ag++ad +R+r+ + L++a ++l+ ++
  VIMSS57774 17 QSYSELQELLSEANSMLADSAAFAGDKADSARARIGALLEKANDALGKGG 66
                6689******************************************8765 PP



Or compare VIMSS57774 to CDD or PaperBLAST